Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IA00

Protein Details
Accession A0A1B9IA00   
Localization Confidence High
Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-47VKTNKTKSKVKVLKTYGKPRSSSSTTSNNKQKPKTKAKVKSVITPSHydrophilic
201-222TKEDEKPKTKINRGRAGKKEVVBasic
NLS Segment(s)
PositionSequence
113-118AKKQIR
208-218KTKINRGRAGK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MVKTNKTKSKVKVLKTYGKPRSSSSTTSNNKQKPKTKAKVKSVITPSDDVDKKTIDNGIDHNEEENQNENQKLEMDNLIRKILCLVFENTKNVDWFDLTKKLNYPTLKNNGKAKKQIRGKKEDIVMMNGVELRDYFNDIILPRLKSNEFILPHKSVRSSSNDHLESPALSAQGSKLSKTEASEDTFQLDGEEESQLVLPVTKEDEKPKTKINRGRAGKKEVVIKIGDASDVTWPHLQITNLSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.84
4 0.82
5 0.8
6 0.74
7 0.68
8 0.68
9 0.63
10 0.58
11 0.53
12 0.54
13 0.55
14 0.62
15 0.67
16 0.67
17 0.7
18 0.74
19 0.77
20 0.77
21 0.81
22 0.82
23 0.83
24 0.85
25 0.87
26 0.87
27 0.82
28 0.81
29 0.77
30 0.73
31 0.66
32 0.57
33 0.49
34 0.48
35 0.46
36 0.37
37 0.33
38 0.27
39 0.24
40 0.24
41 0.25
42 0.17
43 0.17
44 0.18
45 0.21
46 0.22
47 0.22
48 0.21
49 0.21
50 0.2
51 0.2
52 0.21
53 0.18
54 0.18
55 0.19
56 0.18
57 0.16
58 0.17
59 0.16
60 0.14
61 0.16
62 0.16
63 0.19
64 0.2
65 0.21
66 0.2
67 0.19
68 0.19
69 0.16
70 0.14
71 0.14
72 0.15
73 0.18
74 0.2
75 0.23
76 0.22
77 0.23
78 0.22
79 0.2
80 0.17
81 0.13
82 0.13
83 0.15
84 0.2
85 0.19
86 0.2
87 0.22
88 0.24
89 0.29
90 0.29
91 0.29
92 0.3
93 0.39
94 0.42
95 0.44
96 0.5
97 0.52
98 0.54
99 0.59
100 0.56
101 0.55
102 0.59
103 0.62
104 0.61
105 0.62
106 0.61
107 0.57
108 0.56
109 0.51
110 0.43
111 0.38
112 0.31
113 0.23
114 0.19
115 0.15
116 0.12
117 0.08
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.08
125 0.08
126 0.12
127 0.14
128 0.15
129 0.13
130 0.16
131 0.16
132 0.16
133 0.18
134 0.21
135 0.2
136 0.21
137 0.26
138 0.27
139 0.28
140 0.27
141 0.27
142 0.23
143 0.24
144 0.27
145 0.28
146 0.29
147 0.36
148 0.36
149 0.35
150 0.35
151 0.32
152 0.26
153 0.22
154 0.19
155 0.1
156 0.09
157 0.09
158 0.08
159 0.14
160 0.15
161 0.14
162 0.13
163 0.15
164 0.17
165 0.18
166 0.22
167 0.18
168 0.22
169 0.24
170 0.23
171 0.24
172 0.22
173 0.21
174 0.17
175 0.14
176 0.11
177 0.09
178 0.09
179 0.07
180 0.07
181 0.07
182 0.07
183 0.06
184 0.07
185 0.06
186 0.07
187 0.11
188 0.14
189 0.17
190 0.24
191 0.33
192 0.37
193 0.41
194 0.49
195 0.54
196 0.61
197 0.67
198 0.7
199 0.71
200 0.76
201 0.82
202 0.82
203 0.8
204 0.76
205 0.72
206 0.71
207 0.63
208 0.57
209 0.48
210 0.41
211 0.35
212 0.29
213 0.26
214 0.17
215 0.15
216 0.16
217 0.16
218 0.19
219 0.18
220 0.18
221 0.2
222 0.23
223 0.23