Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9HV28

Protein Details
Accession A0A1B9HV28   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-30IIMTPRSRKSQKSTSRKNRNITPPSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDPIIMTPRSRKSQKSTSRKNRNITPPSGDSDADASDHTAHAGKKSNLKMMYMDESENEENGKRLSATSTLSSRTISFGQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.73
4 0.78
5 0.8
6 0.86
7 0.88
8 0.88
9 0.86
10 0.86
11 0.81
12 0.74
13 0.69
14 0.61
15 0.56
16 0.51
17 0.42
18 0.31
19 0.26
20 0.22
21 0.16
22 0.13
23 0.09
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.14
31 0.15
32 0.21
33 0.23
34 0.29
35 0.28
36 0.28
37 0.28
38 0.26
39 0.28
40 0.23
41 0.22
42 0.16
43 0.2
44 0.2
45 0.19
46 0.17
47 0.13
48 0.13
49 0.13
50 0.13
51 0.09
52 0.09
53 0.11
54 0.12
55 0.15
56 0.18
57 0.21
58 0.23
59 0.24
60 0.24
61 0.23
62 0.24
63 0.22