Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IDX8

Protein Details
Accession A0A1B9IDX8    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
390-411YNKFQFFFNKKFQNKSKIKFQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027706  PGP_Pase  
Gene Ontology GO:0008962  F:phosphatidylglycerophosphatase activity  
Pfam View protein in Pfam  
PF09419  PGP_phosphatase  
Amino Acid Sequences MTPIQLPNILIYLTGIIRPKLLRPNLKVTSIAQINFKSLKNQGYNAIVIDKDNCLTLPNKDEIYPPYQIAWNNLLNTFNPERVLIVSNSAGTKKDPGGIAAESVSLSLKAPILIHGQNKPGCSKDIISYFKGNLGKPITIRKKLIKENEKVIKEEKEDEEMLRLRWEDEIYKKPLLGYNHPSDSKLNERKGNIVTIEKQLKNSTISNKSNEIENNNNNNNNKEEEEELKLIVIGDRLFTDILLSHRLSLYLNKSKNIKTKNSLPSVLSIYTTSLPKYNDVRLLRWIEEKLSKSKIKGNFNFNQFKLKDKNEESINLNFIENKKQNKFIEFFKWFKISKWKEFYNSLPPLNLKNPKSWKPLPILFGLIKNLNYLISLIFKFIIVKSLNFGYNKFQFFFNKKFQNKSKIKFQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.18
5 0.2
6 0.25
7 0.32
8 0.41
9 0.47
10 0.5
11 0.6
12 0.61
13 0.63
14 0.59
15 0.52
16 0.52
17 0.47
18 0.43
19 0.38
20 0.34
21 0.36
22 0.38
23 0.37
24 0.33
25 0.33
26 0.39
27 0.38
28 0.39
29 0.39
30 0.38
31 0.39
32 0.35
33 0.33
34 0.25
35 0.22
36 0.21
37 0.18
38 0.15
39 0.14
40 0.13
41 0.12
42 0.14
43 0.17
44 0.2
45 0.22
46 0.23
47 0.23
48 0.27
49 0.28
50 0.31
51 0.3
52 0.26
53 0.24
54 0.27
55 0.27
56 0.28
57 0.29
58 0.28
59 0.27
60 0.27
61 0.26
62 0.23
63 0.29
64 0.27
65 0.23
66 0.2
67 0.19
68 0.18
69 0.19
70 0.22
71 0.15
72 0.16
73 0.15
74 0.16
75 0.17
76 0.17
77 0.16
78 0.14
79 0.17
80 0.15
81 0.18
82 0.17
83 0.17
84 0.19
85 0.18
86 0.18
87 0.15
88 0.14
89 0.1
90 0.1
91 0.1
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.09
99 0.13
100 0.17
101 0.2
102 0.23
103 0.29
104 0.3
105 0.31
106 0.31
107 0.28
108 0.27
109 0.25
110 0.24
111 0.23
112 0.28
113 0.31
114 0.32
115 0.33
116 0.31
117 0.34
118 0.36
119 0.31
120 0.29
121 0.28
122 0.26
123 0.26
124 0.36
125 0.38
126 0.39
127 0.44
128 0.45
129 0.5
130 0.56
131 0.65
132 0.63
133 0.6
134 0.65
135 0.69
136 0.64
137 0.58
138 0.54
139 0.48
140 0.41
141 0.41
142 0.33
143 0.28
144 0.27
145 0.25
146 0.26
147 0.23
148 0.21
149 0.18
150 0.17
151 0.14
152 0.14
153 0.14
154 0.13
155 0.17
156 0.23
157 0.25
158 0.26
159 0.25
160 0.25
161 0.28
162 0.28
163 0.29
164 0.29
165 0.3
166 0.34
167 0.34
168 0.34
169 0.31
170 0.31
171 0.35
172 0.36
173 0.36
174 0.35
175 0.35
176 0.38
177 0.39
178 0.37
179 0.29
180 0.25
181 0.23
182 0.24
183 0.31
184 0.27
185 0.28
186 0.27
187 0.26
188 0.26
189 0.27
190 0.28
191 0.29
192 0.31
193 0.32
194 0.34
195 0.34
196 0.34
197 0.32
198 0.3
199 0.28
200 0.31
201 0.35
202 0.35
203 0.39
204 0.37
205 0.37
206 0.35
207 0.3
208 0.25
209 0.2
210 0.18
211 0.17
212 0.19
213 0.18
214 0.16
215 0.14
216 0.13
217 0.12
218 0.1
219 0.09
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.07
229 0.1
230 0.1
231 0.1
232 0.1
233 0.11
234 0.11
235 0.14
236 0.2
237 0.25
238 0.26
239 0.29
240 0.33
241 0.38
242 0.45
243 0.47
244 0.46
245 0.44
246 0.52
247 0.58
248 0.58
249 0.56
250 0.49
251 0.45
252 0.42
253 0.37
254 0.28
255 0.2
256 0.17
257 0.16
258 0.16
259 0.14
260 0.14
261 0.15
262 0.18
263 0.21
264 0.22
265 0.28
266 0.29
267 0.31
268 0.34
269 0.36
270 0.34
271 0.34
272 0.32
273 0.28
274 0.31
275 0.33
276 0.31
277 0.35
278 0.36
279 0.35
280 0.41
281 0.45
282 0.5
283 0.54
284 0.58
285 0.58
286 0.63
287 0.69
288 0.62
289 0.64
290 0.54
291 0.54
292 0.52
293 0.49
294 0.5
295 0.45
296 0.5
297 0.44
298 0.48
299 0.45
300 0.41
301 0.39
302 0.31
303 0.29
304 0.26
305 0.24
306 0.3
307 0.31
308 0.36
309 0.38
310 0.45
311 0.47
312 0.49
313 0.51
314 0.47
315 0.51
316 0.5
317 0.49
318 0.46
319 0.5
320 0.45
321 0.46
322 0.52
323 0.49
324 0.53
325 0.58
326 0.58
327 0.57
328 0.61
329 0.62
330 0.61
331 0.59
332 0.51
333 0.47
334 0.44
335 0.44
336 0.48
337 0.51
338 0.43
339 0.46
340 0.54
341 0.58
342 0.65
343 0.65
344 0.63
345 0.63
346 0.66
347 0.6
348 0.54
349 0.52
350 0.45
351 0.42
352 0.4
353 0.34
354 0.29
355 0.27
356 0.24
357 0.19
358 0.17
359 0.15
360 0.12
361 0.13
362 0.13
363 0.13
364 0.13
365 0.13
366 0.15
367 0.14
368 0.2
369 0.17
370 0.17
371 0.2
372 0.24
373 0.28
374 0.28
375 0.29
376 0.31
377 0.36
378 0.39
379 0.37
380 0.37
381 0.4
382 0.46
383 0.52
384 0.54
385 0.57
386 0.6
387 0.69
388 0.74
389 0.77
390 0.8
391 0.8