Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9HWE5

Protein Details
Accession A0A1B9HWE5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ELSKYNHKLKIKKEKRLNSPNEDNLHydrophilic
NLS Segment(s)
PositionSequence
54-62KKLKTKTNK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MTKSESIKSSSIKNEDELSKYNHKLKIKKEKRLNSPNEDNLDQESESEFEQVKKKLKTKTNKNHKSIGKSWKSEEDWKLFQILHPKINKPDWNNISSLIGNERDSKSCQNRYSIISKRLEGAIKSIGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.41
4 0.38
5 0.37
6 0.39
7 0.42
8 0.46
9 0.47
10 0.51
11 0.54
12 0.61
13 0.66
14 0.68
15 0.74
16 0.77
17 0.8
18 0.84
19 0.88
20 0.86
21 0.83
22 0.82
23 0.77
24 0.72
25 0.63
26 0.53
27 0.45
28 0.39
29 0.3
30 0.22
31 0.16
32 0.12
33 0.11
34 0.11
35 0.1
36 0.1
37 0.15
38 0.18
39 0.24
40 0.28
41 0.34
42 0.41
43 0.48
44 0.56
45 0.63
46 0.7
47 0.75
48 0.8
49 0.78
50 0.79
51 0.75
52 0.71
53 0.67
54 0.67
55 0.62
56 0.55
57 0.53
58 0.51
59 0.5
60 0.5
61 0.47
62 0.42
63 0.37
64 0.35
65 0.34
66 0.28
67 0.26
68 0.29
69 0.27
70 0.28
71 0.3
72 0.32
73 0.35
74 0.42
75 0.46
76 0.41
77 0.49
78 0.47
79 0.45
80 0.43
81 0.4
82 0.36
83 0.3
84 0.27
85 0.2
86 0.17
87 0.17
88 0.21
89 0.22
90 0.22
91 0.25
92 0.33
93 0.38
94 0.45
95 0.46
96 0.46
97 0.48
98 0.5
99 0.56
100 0.56
101 0.56
102 0.52
103 0.5
104 0.48
105 0.49
106 0.47
107 0.39
108 0.34
109 0.3