Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I3L2

Protein Details
Accession A0A1B9I3L2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-122ADQSGMKKRRKRGDKPWTEHKYSBasic
NLS Segment(s)
PositionSequence
106-114KKRRKRGDK
202-213IKGRGKYGIKHH
235-244KFAKDLRKVR
Subcellular Location(s) mito 20, mito_nucl 12.666, cyto_mito 11.666, nucl 4, cyto_nucl 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR036394  Ribosomal_L22/L17_sf  
IPR005727  Ribosomal_L22_bac/chlpt-type  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
Amino Acid Sequences MARPLRSIFTVAQTSIAGPSSLRPLNPALKTASPYQVRTAFNLSGWDRYLPKLPKWTSEEEQPTKSEGGVTMIEEKGKEITNEETSTGGLFDEYSKDKDADQSGMKKRRKRGDKPWTEHKYSSALHKISHRKLNDLSRQISNLPIDEAIVQMQFSEKRASKWIKSTLALSRDHAIDKGLDRSKLVVAETWVSKGPKIARLDIKGRGKYGIKHHPSTKIHVLLKEGKTPEEKLAEKFAKDLRKVRSAGVVREDGKIRRKVISGWTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.13
5 0.1
6 0.11
7 0.17
8 0.18
9 0.18
10 0.19
11 0.23
12 0.31
13 0.32
14 0.33
15 0.31
16 0.32
17 0.35
18 0.36
19 0.4
20 0.36
21 0.37
22 0.4
23 0.42
24 0.41
25 0.41
26 0.43
27 0.35
28 0.31
29 0.36
30 0.31
31 0.27
32 0.27
33 0.27
34 0.23
35 0.24
36 0.32
37 0.3
38 0.33
39 0.39
40 0.4
41 0.44
42 0.48
43 0.53
44 0.48
45 0.52
46 0.58
47 0.53
48 0.54
49 0.48
50 0.45
51 0.38
52 0.35
53 0.26
54 0.17
55 0.15
56 0.13
57 0.13
58 0.14
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.13
65 0.12
66 0.11
67 0.14
68 0.17
69 0.18
70 0.18
71 0.17
72 0.16
73 0.15
74 0.13
75 0.1
76 0.06
77 0.05
78 0.05
79 0.08
80 0.09
81 0.11
82 0.12
83 0.13
84 0.13
85 0.16
86 0.17
87 0.18
88 0.2
89 0.26
90 0.34
91 0.43
92 0.49
93 0.51
94 0.58
95 0.64
96 0.7
97 0.71
98 0.73
99 0.75
100 0.8
101 0.81
102 0.85
103 0.82
104 0.76
105 0.68
106 0.58
107 0.52
108 0.42
109 0.4
110 0.36
111 0.3
112 0.27
113 0.34
114 0.4
115 0.4
116 0.46
117 0.41
118 0.38
119 0.41
120 0.48
121 0.48
122 0.45
123 0.43
124 0.37
125 0.38
126 0.35
127 0.32
128 0.25
129 0.18
130 0.13
131 0.1
132 0.09
133 0.08
134 0.08
135 0.06
136 0.05
137 0.05
138 0.04
139 0.06
140 0.06
141 0.07
142 0.12
143 0.13
144 0.14
145 0.22
146 0.27
147 0.28
148 0.34
149 0.39
150 0.38
151 0.38
152 0.4
153 0.38
154 0.38
155 0.36
156 0.32
157 0.27
158 0.25
159 0.25
160 0.21
161 0.16
162 0.14
163 0.14
164 0.2
165 0.2
166 0.2
167 0.19
168 0.21
169 0.21
170 0.21
171 0.2
172 0.14
173 0.12
174 0.15
175 0.15
176 0.15
177 0.17
178 0.16
179 0.16
180 0.19
181 0.21
182 0.24
183 0.27
184 0.32
185 0.35
186 0.4
187 0.44
188 0.49
189 0.55
190 0.51
191 0.48
192 0.47
193 0.43
194 0.44
195 0.48
196 0.5
197 0.48
198 0.52
199 0.56
200 0.61
201 0.61
202 0.62
203 0.61
204 0.59
205 0.56
206 0.51
207 0.53
208 0.52
209 0.52
210 0.51
211 0.45
212 0.4
213 0.4
214 0.4
215 0.39
216 0.37
217 0.37
218 0.33
219 0.41
220 0.41
221 0.38
222 0.4
223 0.41
224 0.43
225 0.47
226 0.51
227 0.48
228 0.52
229 0.53
230 0.51
231 0.55
232 0.51
233 0.51
234 0.5
235 0.5
236 0.44
237 0.47
238 0.5
239 0.46
240 0.5
241 0.52
242 0.48
243 0.45
244 0.46
245 0.46