Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9HWW1

Protein Details
Accession A0A1B9HWW1   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-33AKSTNNENISRKKRSKNKKDNEIRINSKQLHydrophilic
NLS Segment(s)
PositionSequence
14-22RKKRSKNKK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MTRAKSTNNENISRKKRSKNKKDNEIRINSKQLLEKSDNEFQKKNKVSDEKTIPTSSEFIKDESKISIPVKIGEDIKFEVHKKLMSTGSFGWSGNRNSKITLGDGKNVNVSISVNIVVQNSSSQKKDSLAKEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.78
4 0.81
5 0.86
6 0.87
7 0.89
8 0.9
9 0.93
10 0.93
11 0.93
12 0.91
13 0.88
14 0.82
15 0.78
16 0.69
17 0.61
18 0.55
19 0.47
20 0.44
21 0.4
22 0.37
23 0.37
24 0.42
25 0.44
26 0.43
27 0.45
28 0.41
29 0.47
30 0.48
31 0.45
32 0.45
33 0.48
34 0.47
35 0.52
36 0.57
37 0.5
38 0.49
39 0.47
40 0.4
41 0.33
42 0.31
43 0.24
44 0.2
45 0.17
46 0.16
47 0.17
48 0.17
49 0.17
50 0.16
51 0.16
52 0.15
53 0.15
54 0.15
55 0.14
56 0.15
57 0.15
58 0.16
59 0.17
60 0.15
61 0.16
62 0.15
63 0.16
64 0.17
65 0.16
66 0.16
67 0.16
68 0.16
69 0.15
70 0.18
71 0.2
72 0.18
73 0.2
74 0.19
75 0.2
76 0.2
77 0.19
78 0.18
79 0.19
80 0.22
81 0.25
82 0.28
83 0.27
84 0.27
85 0.29
86 0.28
87 0.27
88 0.32
89 0.27
90 0.29
91 0.3
92 0.3
93 0.3
94 0.29
95 0.25
96 0.18
97 0.17
98 0.12
99 0.11
100 0.11
101 0.09
102 0.1
103 0.11
104 0.1
105 0.1
106 0.13
107 0.17
108 0.2
109 0.22
110 0.22
111 0.24
112 0.28
113 0.36