Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I3T8

Protein Details
Accession A0A1B9I3T8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-46RAGNNKPKSLQKTKRTFKPNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Amino Acid Sequences MSKFPNLSTLLSRRSNPSILPISPTRAGNNKPKSLQKTKRTFKPNVTRVDWPINLLSETVGTDKDVLPKLRGVKMQMRRVRDVEKAGGSEGLLLSRASKDLTPFGAYLRSQVFNQLHRIKIDLEAEKRAEAGLPLESGLSGASPIEEAQKAQVPLVEGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.37
4 0.39
5 0.37
6 0.34
7 0.37
8 0.34
9 0.34
10 0.36
11 0.37
12 0.33
13 0.34
14 0.39
15 0.43
16 0.49
17 0.51
18 0.53
19 0.6
20 0.65
21 0.69
22 0.74
23 0.74
24 0.76
25 0.79
26 0.83
27 0.82
28 0.8
29 0.79
30 0.8
31 0.77
32 0.74
33 0.7
34 0.65
35 0.61
36 0.62
37 0.52
38 0.42
39 0.36
40 0.29
41 0.24
42 0.2
43 0.16
44 0.09
45 0.09
46 0.08
47 0.07
48 0.06
49 0.07
50 0.08
51 0.12
52 0.15
53 0.15
54 0.15
55 0.18
56 0.21
57 0.23
58 0.24
59 0.24
60 0.29
61 0.36
62 0.45
63 0.46
64 0.47
65 0.46
66 0.47
67 0.47
68 0.41
69 0.36
70 0.29
71 0.26
72 0.22
73 0.19
74 0.17
75 0.14
76 0.11
77 0.09
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.08
87 0.09
88 0.11
89 0.12
90 0.12
91 0.12
92 0.15
93 0.14
94 0.16
95 0.17
96 0.17
97 0.15
98 0.23
99 0.24
100 0.24
101 0.32
102 0.35
103 0.34
104 0.33
105 0.35
106 0.28
107 0.3
108 0.32
109 0.3
110 0.28
111 0.31
112 0.31
113 0.3
114 0.29
115 0.25
116 0.2
117 0.14
118 0.13
119 0.09
120 0.09
121 0.09
122 0.08
123 0.08
124 0.08
125 0.07
126 0.06
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.09
133 0.1
134 0.1
135 0.13
136 0.19
137 0.19
138 0.19
139 0.21