Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YVZ6

Protein Details
Accession C7YVZ6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
58-87SYGTYGAKPKPKPKPKPAPKKPAPKKYTNYHydrophilic
159-186SYGTYGAKPKPKPKPAPKKPAPKKYTTYHydrophilic
NLS Segment(s)
PositionSequence
65-83KPKPKPKPKPAPKKPAPKK
166-182KPKPKPKPAPKKPAPKK
Subcellular Location(s) extr 15, E.R. 4, cyto 3, mito 2, golg 2
Family & Domain DBs
KEGG nhe:NECHADRAFT_105786  -  
Amino Acid Sequences MKLSAITLLALAAGAIAAPAPAPEAEVAPQEEKREASPGYASYGDYKGAGENLPSYPSYGTYGAKPKPKPKPKPAPKKPAPKKYTNYGSYNYKKYGSYGSYKREEVEKREAEPEVEVEVEKREAEPEAEVDVEKREASPGYATYGDYKGAGENLPSYPSYGTYGAKPKPKPKPAPKKPAPKKYTTYGSYSYKKYGSYGAYKRTTDWIKSWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.04
9 0.05
10 0.06
11 0.07
12 0.08
13 0.11
14 0.14
15 0.16
16 0.17
17 0.19
18 0.2
19 0.2
20 0.2
21 0.22
22 0.2
23 0.19
24 0.2
25 0.18
26 0.2
27 0.2
28 0.19
29 0.18
30 0.19
31 0.17
32 0.15
33 0.15
34 0.12
35 0.12
36 0.11
37 0.09
38 0.1
39 0.1
40 0.12
41 0.11
42 0.12
43 0.11
44 0.12
45 0.14
46 0.14
47 0.14
48 0.17
49 0.24
50 0.28
51 0.35
52 0.39
53 0.45
54 0.54
55 0.64
56 0.7
57 0.74
58 0.8
59 0.84
60 0.9
61 0.92
62 0.92
63 0.9
64 0.92
65 0.91
66 0.91
67 0.86
68 0.84
69 0.78
70 0.76
71 0.75
72 0.7
73 0.63
74 0.56
75 0.59
76 0.55
77 0.54
78 0.47
79 0.4
80 0.34
81 0.32
82 0.31
83 0.25
84 0.27
85 0.28
86 0.32
87 0.34
88 0.34
89 0.33
90 0.36
91 0.35
92 0.33
93 0.37
94 0.33
95 0.31
96 0.33
97 0.32
98 0.26
99 0.24
100 0.2
101 0.11
102 0.1
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.09
126 0.09
127 0.11
128 0.12
129 0.12
130 0.14
131 0.14
132 0.14
133 0.13
134 0.12
135 0.1
136 0.1
137 0.1
138 0.08
139 0.09
140 0.1
141 0.11
142 0.11
143 0.12
144 0.11
145 0.12
146 0.14
147 0.14
148 0.14
149 0.17
150 0.24
151 0.28
152 0.35
153 0.39
154 0.45
155 0.54
156 0.63
157 0.7
158 0.74
159 0.81
160 0.84
161 0.9
162 0.9
163 0.91
164 0.91
165 0.91
166 0.86
167 0.83
168 0.78
169 0.75
170 0.75
171 0.67
172 0.63
173 0.59
174 0.61
175 0.59
176 0.57
177 0.53
178 0.46
179 0.43
180 0.39
181 0.38
182 0.35
183 0.39
184 0.43
185 0.47
186 0.52
187 0.52
188 0.52
189 0.56
190 0.56
191 0.5