Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LZQ3

Protein Details
Accession A0A1C7LZQ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-37ILSFHFRPTPHPQNVRRRIKQLKDYISVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 6, mito 5.5, cyto 5.5, extr 4, plas 3, E.R. 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044089  Alr1-like  
IPR045861  CorA_cytoplasmic_dom  
IPR045863  CorA_TM1_TM2  
IPR002523  MgTranspt_CorA/ZnTranspt_ZntB  
Gene Ontology GO:0016020  C:membrane  
GO:0015095  F:magnesium ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF01544  CorA  
CDD cd12829  Alr1p-like  
Amino Acid Sequences MYIIVFRDGILSFHFRPTPHPQNVRRRIKQLKDYISVTSDWISYALIDDITDAFGPLIQSIEYEVDSIDELVLILKEAEQSDMLRRIGTCRKKVMGLLRLMGNKADVVKGLAKRCNENWRVAPTSDIGLYLSDIQDHLITMTQNLNHYEKILSRSHSNYLAQISIEMTDANNQINDVLSKLTALGTVLIPMNLITGLWGMNVHVPGQNVENLRWFGSIIGALAAFAIIAGWTTYKIMLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.31
4 0.4
5 0.47
6 0.5
7 0.59
8 0.64
9 0.72
10 0.83
11 0.88
12 0.85
13 0.85
14 0.85
15 0.85
16 0.85
17 0.84
18 0.81
19 0.75
20 0.71
21 0.63
22 0.55
23 0.46
24 0.38
25 0.29
26 0.21
27 0.15
28 0.13
29 0.11
30 0.08
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.06
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.07
54 0.07
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.11
69 0.15
70 0.15
71 0.14
72 0.14
73 0.19
74 0.27
75 0.34
76 0.35
77 0.35
78 0.37
79 0.37
80 0.41
81 0.44
82 0.41
83 0.36
84 0.33
85 0.32
86 0.32
87 0.31
88 0.27
89 0.2
90 0.14
91 0.12
92 0.1
93 0.07
94 0.07
95 0.11
96 0.14
97 0.18
98 0.21
99 0.22
100 0.24
101 0.27
102 0.35
103 0.33
104 0.34
105 0.33
106 0.34
107 0.36
108 0.33
109 0.31
110 0.22
111 0.21
112 0.17
113 0.14
114 0.09
115 0.07
116 0.07
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.08
129 0.08
130 0.1
131 0.12
132 0.14
133 0.13
134 0.14
135 0.14
136 0.14
137 0.18
138 0.19
139 0.19
140 0.21
141 0.23
142 0.25
143 0.27
144 0.26
145 0.24
146 0.22
147 0.21
148 0.17
149 0.15
150 0.13
151 0.1
152 0.09
153 0.07
154 0.06
155 0.08
156 0.09
157 0.09
158 0.09
159 0.08
160 0.08
161 0.09
162 0.09
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.08
188 0.08
189 0.09
190 0.11
191 0.11
192 0.12
193 0.14
194 0.18
195 0.17
196 0.18
197 0.22
198 0.22
199 0.22
200 0.21
201 0.19
202 0.15
203 0.15
204 0.14
205 0.09
206 0.09
207 0.07
208 0.07
209 0.07
210 0.06
211 0.04
212 0.04
213 0.03
214 0.02
215 0.03
216 0.03
217 0.04
218 0.05
219 0.06
220 0.08