Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LJF8

Protein Details
Accession A0A1C7LJF8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-70MPSRLPSRNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSRVGPAKGRAKRNNRDAGHydrophilic
NLS Segment(s)
PositionSequence
8-68RNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSRVGPAKGRAKRNNRD
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPSRLPSRNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSRVGPAKGRAKRNNRDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.85
4 0.86
5 0.87
6 0.88
7 0.87
8 0.86
9 0.85
10 0.86
11 0.83
12 0.82
13 0.81
14 0.78
15 0.77
16 0.75
17 0.74
18 0.71
19 0.73
20 0.73
21 0.73
22 0.74
23 0.75
24 0.78
25 0.79
26 0.8
27 0.82
28 0.81
29 0.83
30 0.84
31 0.85
32 0.85
33 0.84
34 0.81
35 0.78
36 0.73
37 0.69
38 0.68
39 0.64
40 0.64
41 0.64
42 0.68
43 0.66
44 0.7
45 0.73
46 0.71
47 0.75
48 0.75
49 0.76
50 0.77