FuNGI

A0A1C7LR27

Protein Details

Accession

A0A1C7LR27

Localization Confidence

Medium

Confidence Score

13.8

NoLS Segment(s)

Position	Sequence	Protein Nature
85-108	PATPNGPRRRIRCKMCRQELATRE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 22, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR029021 Prot-tyrosine_phosphatase-like

Amino Acid Sequences

MYSQDLNANAALEVIKKSRPNVQPNDGFLEQLEVFHNASFKVSRRDKATRMFYLERVVQDVLNGDGSVETDMFAKFPRTPSDSTPATPNGPRRRIRCKMCRQELATREHMLDHGQLGPATPASASAFSPAASRRPSMHDSKSLSPLNTISPPTSRRPSSSRPLGPMSPLSPSSTFTTISRRPSQQEPSSRPRLGSNSDNRPLKSSLLALDGAGQLGQDLSDLLSLSESALEGGDSTDEEPQQIIETERLPPRAVAGQQSGIPPVVARRLSSSSGVLAHPSDIAAQLSSHPKLAALRLPSTGSGITPLSPGASATSPTRSGPQSPPILARKAPSFVPISPPILANPKCSGYFVEPMKWMEPFLEEGQMSGKILCPNKKCGVKLGNYDWAGVCCSCKEWVVPGFCIHRSKVDEVV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.19
3	0.22
4	0.24
5	0.33
6	0.42
7	0.5
8	0.56
9	0.63
10	0.65
11	0.66
12	0.71
13	0.62
14	0.53
15	0.43
16	0.39
17	0.29
18	0.24
19	0.21
20	0.16
21	0.16
22	0.16
23	0.17
24	0.12
25	0.15
26	0.17
27	0.19
28	0.28
29	0.34
30	0.38
31	0.46
32	0.53
33	0.57
34	0.64
35	0.68
36	0.64
37	0.66
38	0.64
39	0.58
40	0.56
41	0.53
42	0.44
43	0.39
44	0.34
45	0.26
46	0.23
47	0.22
48	0.17
49	0.13
50	0.12
51	0.09
52	0.08
53	0.08
54	0.09
55	0.07
56	0.07
57	0.07
58	0.07
59	0.08
60	0.09
61	0.11
62	0.13
63	0.16
64	0.21
65	0.25
66	0.28
67	0.32
68	0.38
69	0.38
70	0.37
71	0.39
72	0.37
73	0.36
74	0.38
75	0.43
76	0.46
77	0.52
78	0.57
79	0.59
80	0.66
81	0.72
82	0.77
83	0.78
84	0.8
85	0.82
86	0.85
87	0.86
88	0.81
89	0.81
90	0.78
91	0.73
92	0.67
93	0.57
94	0.49
95	0.41
96	0.36
97	0.28
98	0.22
99	0.16
100	0.13
101	0.12
102	0.11
103	0.11
104	0.11
105	0.09
106	0.08
107	0.07
108	0.06
109	0.07
110	0.08
111	0.08
112	0.09
113	0.09
114	0.09
115	0.11
116	0.12
117	0.15
118	0.16
119	0.17
120	0.18
121	0.24
122	0.28
123	0.33
124	0.36
125	0.38
126	0.41
127	0.43
128	0.48
129	0.45
130	0.4
131	0.35
132	0.32
133	0.28
134	0.26
135	0.23
136	0.18
137	0.19
138	0.22
139	0.27
140	0.31
141	0.3
142	0.31
143	0.37
144	0.42
145	0.47
146	0.53
147	0.51
148	0.49
149	0.51
150	0.48
151	0.43
152	0.39
153	0.31
154	0.24
155	0.21
156	0.19
157	0.16
158	0.17
159	0.18
160	0.17
161	0.17
162	0.16
163	0.22
164	0.24
165	0.29
166	0.32
167	0.32
168	0.34
169	0.39
170	0.45
171	0.45
172	0.5
173	0.51
174	0.54
175	0.59
176	0.56
177	0.52
178	0.47
179	0.43
180	0.38
181	0.39
182	0.39
183	0.39
184	0.45
185	0.47
186	0.45
187	0.45
188	0.42
189	0.35
190	0.28
191	0.21
192	0.16
193	0.14
194	0.14
195	0.11
196	0.11
197	0.1
198	0.09
199	0.07
200	0.06
201	0.04
202	0.04
203	0.04
204	0.02
205	0.02
206	0.02
207	0.03
208	0.03
209	0.03
210	0.03
211	0.03
212	0.03
213	0.03
214	0.03
215	0.03
216	0.03
217	0.03
218	0.03
219	0.03
220	0.03
221	0.03
222	0.04
223	0.06
224	0.06
225	0.06
226	0.06
227	0.06
228	0.06
229	0.07
230	0.07
231	0.07
232	0.08
233	0.13
234	0.15
235	0.17
236	0.16
237	0.16
238	0.17
239	0.19
240	0.19
241	0.17
242	0.17
243	0.17
244	0.18
245	0.19
246	0.18
247	0.15
248	0.13
249	0.1
250	0.09
251	0.13
252	0.12
253	0.12
254	0.14
255	0.18
256	0.19
257	0.21
258	0.2
259	0.16
260	0.18
261	0.18
262	0.15
263	0.12
264	0.11
265	0.1
266	0.09
267	0.08
268	0.07
269	0.07
270	0.06
271	0.06
272	0.09
273	0.13
274	0.14
275	0.14
276	0.13
277	0.14
278	0.15
279	0.17
280	0.19
281	0.18
282	0.19
283	0.2
284	0.21
285	0.2
286	0.21
287	0.18
288	0.14
289	0.13
290	0.11
291	0.1
292	0.1
293	0.1
294	0.08
295	0.08
296	0.08
297	0.08
298	0.08
299	0.09
300	0.11
301	0.14
302	0.15
303	0.16
304	0.2
305	0.2
306	0.24
307	0.27
308	0.32
309	0.34
310	0.34
311	0.41
312	0.41
313	0.43
314	0.4
315	0.39
316	0.35
317	0.32
318	0.31
319	0.28
320	0.27
321	0.24
322	0.3
323	0.3
324	0.29
325	0.28
326	0.28
327	0.26
328	0.32
329	0.32
330	0.29
331	0.29
332	0.29
333	0.29
334	0.29
335	0.31
336	0.26
337	0.32
338	0.31
339	0.32
340	0.32
341	0.34
342	0.35
343	0.32
344	0.28
345	0.21
346	0.2
347	0.19
348	0.18
349	0.19
350	0.18
351	0.18
352	0.19
353	0.19
354	0.18
355	0.14
356	0.16
357	0.18
358	0.25
359	0.32
360	0.34
361	0.41
362	0.5
363	0.56
364	0.54
365	0.57
366	0.59
367	0.59
368	0.63
369	0.62
370	0.63
371	0.57
372	0.57
373	0.49
374	0.41
375	0.37
376	0.29
377	0.24
378	0.16
379	0.17
380	0.17
381	0.17
382	0.17
383	0.21
384	0.28
385	0.31
386	0.32
387	0.36
388	0.39
389	0.43
390	0.46
391	0.41
392	0.41
393	0.42

A0A1C7LR27

3D AlphaFold-predicted Structure Viewer