Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZBX9

Protein Details
Accession C7ZBX9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MNKATNRPRAKRKRVSRACDYCRARKHRCDGRRPACSRHydrophilic
NLS Segment(s)
PositionSequence
7-14RPRAKRKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG nhe:NECHADRAFT_55236  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNKATNRPRAKRKRVSRACDYCRARKHRCDGRRPACSRCSATHQPCSYGSDIKKRGLPTGYVRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.89
5 0.85
6 0.84
7 0.79
8 0.76
9 0.75
10 0.76
11 0.72
12 0.69
13 0.72
14 0.72
15 0.75
16 0.76
17 0.77
18 0.77
19 0.8
20 0.76
21 0.72
22 0.66
23 0.62
24 0.56
25 0.48
26 0.47
27 0.47
28 0.49
29 0.53
30 0.5
31 0.48
32 0.45
33 0.46
34 0.4
35 0.37
36 0.36
37 0.37
38 0.4
39 0.41
40 0.44
41 0.41
42 0.44
43 0.4
44 0.42
45 0.39