Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MQJ4

Protein Details
Accession A0A1C7MQJ4   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
180-201DVRFLRRTRSCSRRPPSRGGYIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001765  Carbonic_anhydrase  
IPR036874  Carbonic_anhydrase_sf  
Gene Ontology GO:0004089  F:carbonate dehydratase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00484  Pro_CA  
CDD cd03379  beta_CA_cladeD  
Amino Acid Sequences MPSSRAGCSMADSITSRAPVPCFTEPASRRRTSVHAQAPLRPRRGIWRGVFRFQQRLRARGSKGDLRVNPTKKLIVVTCMDARLNNPFSQLGITEGQAHIIRNAGGLAKDSLRSIIISQRLLGTRKIAVFRHTDCGMTTFTTPELRQRIRDSDPGNDLLNEVDKIDFLEFKNLEKSLRDDVRFLRRTRSCSRRPPSRGGYIMSRRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.19
5 0.2
6 0.2
7 0.25
8 0.25
9 0.26
10 0.28
11 0.37
12 0.38
13 0.45
14 0.5
15 0.45
16 0.44
17 0.44
18 0.48
19 0.44
20 0.51
21 0.51
22 0.51
23 0.52
24 0.58
25 0.64
26 0.65
27 0.63
28 0.53
29 0.46
30 0.47
31 0.5
32 0.51
33 0.49
34 0.52
35 0.53
36 0.57
37 0.63
38 0.57
39 0.61
40 0.55
41 0.58
42 0.51
43 0.5
44 0.51
45 0.52
46 0.51
47 0.47
48 0.51
49 0.48
50 0.48
51 0.52
52 0.48
53 0.47
54 0.54
55 0.51
56 0.48
57 0.43
58 0.4
59 0.32
60 0.33
61 0.27
62 0.22
63 0.2
64 0.2
65 0.19
66 0.19
67 0.18
68 0.16
69 0.16
70 0.18
71 0.19
72 0.16
73 0.15
74 0.14
75 0.14
76 0.15
77 0.14
78 0.11
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.1
86 0.08
87 0.08
88 0.07
89 0.06
90 0.07
91 0.06
92 0.05
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.1
103 0.13
104 0.12
105 0.13
106 0.15
107 0.17
108 0.18
109 0.18
110 0.16
111 0.15
112 0.17
113 0.21
114 0.19
115 0.2
116 0.23
117 0.24
118 0.28
119 0.26
120 0.24
121 0.21
122 0.22
123 0.2
124 0.17
125 0.15
126 0.11
127 0.12
128 0.14
129 0.14
130 0.18
131 0.25
132 0.26
133 0.29
134 0.33
135 0.37
136 0.38
137 0.45
138 0.41
139 0.39
140 0.41
141 0.39
142 0.36
143 0.3
144 0.26
145 0.2
146 0.19
147 0.14
148 0.11
149 0.09
150 0.08
151 0.09
152 0.1
153 0.11
154 0.1
155 0.18
156 0.18
157 0.2
158 0.24
159 0.24
160 0.24
161 0.24
162 0.27
163 0.29
164 0.36
165 0.35
166 0.35
167 0.4
168 0.5
169 0.54
170 0.52
171 0.53
172 0.51
173 0.56
174 0.63
175 0.67
176 0.65
177 0.7
178 0.78
179 0.79
180 0.8
181 0.83
182 0.81
183 0.8
184 0.74
185 0.68
186 0.69
187 0.67