Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z5U4

Protein Details
Accession C7Z5U4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-121TWSVEHRSSPRRRYRRPPSPPRPKRLKPRQRLPWQLLQQHydrophilic
NLS Segment(s)
PositionSequence
90-113SSPRRRYRRPPSPPRPKRLKPRQR
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
KEGG nhe:NECHADRAFT_75871  -  
Amino Acid Sequences MGWDKSALEQVSHNTTVFAKIGGEAAYVLSDTCNATAEATTYLWDPDWQTVLVAKKGSLTESVVTGTYDNFLTITDGKSVNSTWSVEHRSSPRRRYRRPPSPPRPKRLKPRQRLPWQLLQQPVRSLHPTTTNITLRARHTATSTRRRKVAKLLLPKSAKIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.21
5 0.17
6 0.12
7 0.1
8 0.12
9 0.1
10 0.1
11 0.08
12 0.07
13 0.07
14 0.07
15 0.06
16 0.05
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.08
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.1
32 0.1
33 0.09
34 0.11
35 0.1
36 0.1
37 0.13
38 0.15
39 0.16
40 0.15
41 0.14
42 0.14
43 0.15
44 0.15
45 0.13
46 0.12
47 0.11
48 0.11
49 0.12
50 0.1
51 0.1
52 0.09
53 0.08
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.12
72 0.15
73 0.15
74 0.18
75 0.22
76 0.31
77 0.37
78 0.46
79 0.53
80 0.59
81 0.67
82 0.74
83 0.8
84 0.82
85 0.86
86 0.88
87 0.89
88 0.9
89 0.92
90 0.91
91 0.9
92 0.88
93 0.88
94 0.88
95 0.88
96 0.87
97 0.89
98 0.9
99 0.9
100 0.91
101 0.85
102 0.84
103 0.79
104 0.74
105 0.71
106 0.64
107 0.56
108 0.51
109 0.47
110 0.4
111 0.37
112 0.33
113 0.28
114 0.31
115 0.32
116 0.31
117 0.36
118 0.35
119 0.35
120 0.37
121 0.38
122 0.34
123 0.38
124 0.36
125 0.3
126 0.31
127 0.38
128 0.44
129 0.51
130 0.58
131 0.57
132 0.63
133 0.66
134 0.66
135 0.68
136 0.69
137 0.67
138 0.69
139 0.68
140 0.71
141 0.7
142 0.68