Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LPK7

Protein Details
Accession A0A1C7LPK7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-90RRLPTSPWKPLARKRSRARAAHydrophilic
NLS Segment(s)
PositionSequence
73-90PTSPWKPLARKRSRARAA
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MARLLTSSHQASHDPSRHDHAGPERNSPARDDRQISTSRRSRSCPNPLSVELGGSGYITILCTHHDRSGRRLPTSPWKPLARKRSRARAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.41
4 0.42
5 0.41
6 0.41
7 0.4
8 0.44
9 0.42
10 0.44
11 0.42
12 0.43
13 0.43
14 0.41
15 0.39
16 0.36
17 0.39
18 0.37
19 0.34
20 0.36
21 0.41
22 0.41
23 0.42
24 0.43
25 0.44
26 0.43
27 0.45
28 0.47
29 0.5
30 0.57
31 0.52
32 0.49
33 0.47
34 0.45
35 0.46
36 0.39
37 0.31
38 0.21
39 0.17
40 0.14
41 0.09
42 0.08
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.06
49 0.09
50 0.12
51 0.16
52 0.22
53 0.23
54 0.3
55 0.4
56 0.43
57 0.44
58 0.45
59 0.47
60 0.52
61 0.58
62 0.58
63 0.56
64 0.59
65 0.64
66 0.71
67 0.76
68 0.76
69 0.79
70 0.81