Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LVW5

Protein Details
Accession A0A1C7LVW5   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-69QPFPAVPTTRRRRRRSSTGRSCNAVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, nucl 6, mito 5, cyto 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQLSNWQPGLSSTFRNVQVRADWLVQASHNIIDRRWPASTGLCAQPFPAVPTTRRRRRRSSTGRSCNAVLLLPLLLPVFCFAADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.31
5 0.3
6 0.31
7 0.31
8 0.26
9 0.21
10 0.19
11 0.19
12 0.17
13 0.15
14 0.13
15 0.12
16 0.14
17 0.15
18 0.14
19 0.18
20 0.2
21 0.21
22 0.2
23 0.2
24 0.17
25 0.18
26 0.2
27 0.18
28 0.2
29 0.18
30 0.17
31 0.16
32 0.16
33 0.15
34 0.14
35 0.15
36 0.13
37 0.15
38 0.25
39 0.35
40 0.45
41 0.55
42 0.6
43 0.66
44 0.72
45 0.81
46 0.82
47 0.83
48 0.85
49 0.85
50 0.84
51 0.78
52 0.7
53 0.6
54 0.5
55 0.39
56 0.28
57 0.18
58 0.13
59 0.09
60 0.09
61 0.08
62 0.07
63 0.06
64 0.07
65 0.07