Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MBI2

Protein Details
Accession A0A1C7MBI2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78PTPPRRGHPPIRPPRHPRAECBasic
NLS Segment(s)
PositionSequence
66-70PPIRP
Subcellular Location(s) mito 12, extr 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
PF13561  adh_short_C2  
Amino Acid Sequences MSLPLAGKVALITGSSRAIGAATATRLAADGANVVINYVSNAAAATSVADAINANGQPTPPRRGHPPIRPPRHPRAECGHHGEAAGLSDVDDKFFDDHFSINVKAPLFMVKAAAPLMKAGGRIIFFSSTLTHASTITPTTSSMRRRRVQSSRYPACSPRSSARADQCQYRRPGPIDTELFRSGKSEELIKFIGGFHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.09
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.13
45 0.17
46 0.22
47 0.22
48 0.24
49 0.31
50 0.39
51 0.48
52 0.53
53 0.6
54 0.65
55 0.72
56 0.79
57 0.8
58 0.81
59 0.83
60 0.74
61 0.68
62 0.66
63 0.64
64 0.6
65 0.6
66 0.51
67 0.4
68 0.39
69 0.34
70 0.25
71 0.19
72 0.14
73 0.06
74 0.05
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.06
84 0.07
85 0.07
86 0.09
87 0.1
88 0.1
89 0.12
90 0.11
91 0.11
92 0.11
93 0.12
94 0.1
95 0.09
96 0.09
97 0.07
98 0.08
99 0.08
100 0.08
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.06
107 0.08
108 0.08
109 0.08
110 0.1
111 0.09
112 0.09
113 0.09
114 0.1
115 0.1
116 0.11
117 0.11
118 0.1
119 0.1
120 0.1
121 0.1
122 0.11
123 0.1
124 0.09
125 0.1
126 0.12
127 0.18
128 0.26
129 0.33
130 0.41
131 0.47
132 0.52
133 0.6
134 0.66
135 0.69
136 0.71
137 0.73
138 0.73
139 0.73
140 0.72
141 0.67
142 0.64
143 0.6
144 0.54
145 0.5
146 0.46
147 0.45
148 0.48
149 0.52
150 0.54
151 0.53
152 0.57
153 0.57
154 0.61
155 0.62
156 0.59
157 0.57
158 0.5
159 0.53
160 0.48
161 0.5
162 0.48
163 0.45
164 0.47
165 0.45
166 0.42
167 0.37
168 0.34
169 0.27
170 0.25
171 0.24
172 0.24
173 0.21
174 0.25
175 0.27
176 0.25
177 0.25