Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7M7Z5

Protein Details
Accession A0A1C7M7Z5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-143RQGMCVSRRPQRWRRARNQTRTPCSRQTSHydrophilic
379-399GYLMKCGSRRHNWHKRWFVLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
Pfam View protein in Pfam  
PF00169  PH  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MAEPASISIRLGYKRDNRAKIIWDLREFPKKQRYLLTIRLAANREVTQSNRFDRHNSIELSKLRLQTVAQRSAAQRPACPPATARDHSHVDPLRTATIAPRSDAQALSALRQAARQGMCVSRRPQRWRRARNQTRTPCSRQTSYPLAHVYRQRERQLLAAASAQPPLSSIAERRSASGEESEEDEEDEEGGWRADAPDRERGAPDEIVIKTGYLWKKGERRKVHVEEAWFVLRPAHLAFYKTSAEYKLLRLLDLNEIHSCTPVALKKQRHVRARVPHPHVLSAGGSPGRGAGVAPATAPIPIPGSPTTARAPFGASRLSSSPSQSPCAHQFTSSESDDASPNGPHSYPVSSPSGPGCEVSTASKQTGAVKDASKPVLSGYLMKCGSRRHNWHKRWFVLSGEKLIYCRSHMYTGRTQDTKPHRQIPLSLILDALEYDLPPHRNNPNVSGPPVVSPPQASSSAADEGDGTQGTHTFKVVTTKRTLLLCAPSEEEEIKWLSAVRALIARRSGQVWCPGTWLQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.62
4 0.63
5 0.65
6 0.67
7 0.68
8 0.68
9 0.65
10 0.6
11 0.59
12 0.61
13 0.66
14 0.63
15 0.62
16 0.63
17 0.6
18 0.6
19 0.62
20 0.62
21 0.6
22 0.66
23 0.66
24 0.63
25 0.63
26 0.65
27 0.59
28 0.53
29 0.49
30 0.41
31 0.36
32 0.32
33 0.32
34 0.32
35 0.35
36 0.4
37 0.42
38 0.42
39 0.43
40 0.46
41 0.5
42 0.5
43 0.47
44 0.43
45 0.45
46 0.46
47 0.48
48 0.47
49 0.43
50 0.37
51 0.35
52 0.33
53 0.35
54 0.41
55 0.41
56 0.37
57 0.39
58 0.41
59 0.47
60 0.53
61 0.45
62 0.4
63 0.37
64 0.43
65 0.41
66 0.39
67 0.33
68 0.34
69 0.41
70 0.41
71 0.42
72 0.4
73 0.43
74 0.43
75 0.51
76 0.47
77 0.41
78 0.4
79 0.37
80 0.32
81 0.28
82 0.27
83 0.22
84 0.26
85 0.25
86 0.23
87 0.23
88 0.25
89 0.27
90 0.26
91 0.23
92 0.21
93 0.2
94 0.21
95 0.21
96 0.2
97 0.18
98 0.19
99 0.18
100 0.19
101 0.19
102 0.19
103 0.19
104 0.24
105 0.27
106 0.33
107 0.37
108 0.39
109 0.47
110 0.56
111 0.62
112 0.67
113 0.74
114 0.79
115 0.85
116 0.87
117 0.9
118 0.9
119 0.92
120 0.92
121 0.9
122 0.88
123 0.85
124 0.82
125 0.77
126 0.7
127 0.62
128 0.58
129 0.56
130 0.5
131 0.48
132 0.44
133 0.4
134 0.42
135 0.44
136 0.45
137 0.46
138 0.51
139 0.5
140 0.48
141 0.46
142 0.45
143 0.44
144 0.37
145 0.3
146 0.25
147 0.23
148 0.21
149 0.21
150 0.17
151 0.12
152 0.12
153 0.13
154 0.11
155 0.1
156 0.12
157 0.15
158 0.21
159 0.22
160 0.22
161 0.22
162 0.22
163 0.22
164 0.22
165 0.19
166 0.14
167 0.16
168 0.16
169 0.13
170 0.13
171 0.12
172 0.1
173 0.09
174 0.08
175 0.06
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.08
182 0.11
183 0.14
184 0.21
185 0.22
186 0.24
187 0.24
188 0.25
189 0.26
190 0.23
191 0.21
192 0.18
193 0.17
194 0.17
195 0.16
196 0.14
197 0.11
198 0.17
199 0.18
200 0.16
201 0.18
202 0.22
203 0.31
204 0.38
205 0.47
206 0.47
207 0.53
208 0.6
209 0.64
210 0.64
211 0.59
212 0.54
213 0.46
214 0.43
215 0.37
216 0.27
217 0.21
218 0.16
219 0.13
220 0.11
221 0.1
222 0.09
223 0.09
224 0.1
225 0.1
226 0.13
227 0.14
228 0.14
229 0.14
230 0.13
231 0.14
232 0.14
233 0.15
234 0.18
235 0.17
236 0.16
237 0.16
238 0.17
239 0.19
240 0.18
241 0.19
242 0.14
243 0.14
244 0.14
245 0.14
246 0.12
247 0.08
248 0.09
249 0.1
250 0.15
251 0.21
252 0.24
253 0.3
254 0.4
255 0.47
256 0.52
257 0.56
258 0.58
259 0.61
260 0.68
261 0.72
262 0.69
263 0.66
264 0.6
265 0.55
266 0.47
267 0.38
268 0.29
269 0.19
270 0.15
271 0.1
272 0.09
273 0.08
274 0.07
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.05
287 0.06
288 0.06
289 0.09
290 0.09
291 0.12
292 0.13
293 0.16
294 0.17
295 0.17
296 0.18
297 0.16
298 0.18
299 0.16
300 0.17
301 0.16
302 0.14
303 0.15
304 0.16
305 0.18
306 0.16
307 0.17
308 0.21
309 0.21
310 0.25
311 0.24
312 0.27
313 0.29
314 0.34
315 0.32
316 0.27
317 0.26
318 0.26
319 0.3
320 0.27
321 0.22
322 0.17
323 0.18
324 0.18
325 0.18
326 0.15
327 0.1
328 0.1
329 0.11
330 0.11
331 0.11
332 0.12
333 0.14
334 0.13
335 0.16
336 0.2
337 0.18
338 0.2
339 0.2
340 0.21
341 0.18
342 0.18
343 0.15
344 0.12
345 0.12
346 0.14
347 0.17
348 0.16
349 0.17
350 0.17
351 0.17
352 0.21
353 0.23
354 0.22
355 0.22
356 0.21
357 0.24
358 0.27
359 0.28
360 0.23
361 0.21
362 0.19
363 0.19
364 0.18
365 0.21
366 0.17
367 0.24
368 0.24
369 0.25
370 0.27
371 0.29
372 0.36
373 0.4
374 0.49
375 0.52
376 0.62
377 0.71
378 0.79
379 0.83
380 0.8
381 0.76
382 0.68
383 0.63
384 0.61
385 0.55
386 0.49
387 0.42
388 0.37
389 0.33
390 0.32
391 0.28
392 0.2
393 0.22
394 0.19
395 0.24
396 0.27
397 0.33
398 0.38
399 0.44
400 0.49
401 0.48
402 0.46
403 0.48
404 0.54
405 0.58
406 0.58
407 0.59
408 0.57
409 0.56
410 0.6
411 0.55
412 0.56
413 0.47
414 0.4
415 0.32
416 0.28
417 0.25
418 0.21
419 0.18
420 0.08
421 0.06
422 0.07
423 0.12
424 0.15
425 0.16
426 0.21
427 0.24
428 0.31
429 0.34
430 0.38
431 0.44
432 0.45
433 0.46
434 0.44
435 0.4
436 0.36
437 0.37
438 0.33
439 0.24
440 0.21
441 0.21
442 0.22
443 0.23
444 0.22
445 0.2
446 0.21
447 0.22
448 0.21
449 0.18
450 0.15
451 0.14
452 0.15
453 0.14
454 0.11
455 0.08
456 0.11
457 0.13
458 0.13
459 0.13
460 0.12
461 0.13
462 0.23
463 0.28
464 0.31
465 0.34
466 0.37
467 0.41
468 0.42
469 0.43
470 0.38
471 0.4
472 0.37
473 0.35
474 0.34
475 0.32
476 0.33
477 0.32
478 0.28
479 0.23
480 0.22
481 0.19
482 0.17
483 0.16
484 0.13
485 0.16
486 0.16
487 0.15
488 0.18
489 0.2
490 0.23
491 0.26
492 0.28
493 0.27
494 0.29
495 0.3
496 0.29
497 0.37
498 0.36
499 0.32
500 0.36
501 0.35