Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MQW2

Protein Details
Accession A0A1C7MQW2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-47SPCVVWHPRRTPHRRIYPRDIRPDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.333, mito 6, cyto 5.5, cyto_pero 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013154  ADH-like_N  
IPR011032  GroES-like_sf  
Pfam View protein in Pfam  
PF08240  ADH_N  
Amino Acid Sequences MLWGHSLPWYVHNTKHSKRHHESPCVVWHPRRTPHRRIYPRDIRPDVILKISRSAMFGSDLHLHHGEIAALQKGDILGHEFMGMVDKIGPNFNNLQVSQRIVALFQKYCLRSMQVLQAEVIVKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.62
4 0.66
5 0.7
6 0.76
7 0.77
8 0.78
9 0.75
10 0.71
11 0.71
12 0.67
13 0.65
14 0.6
15 0.59
16 0.57
17 0.61
18 0.66
19 0.64
20 0.67
21 0.73
22 0.79
23 0.8
24 0.81
25 0.83
26 0.83
27 0.83
28 0.83
29 0.76
30 0.66
31 0.6
32 0.55
33 0.46
34 0.4
35 0.35
36 0.25
37 0.24
38 0.24
39 0.21
40 0.18
41 0.17
42 0.13
43 0.12
44 0.12
45 0.12
46 0.14
47 0.14
48 0.16
49 0.16
50 0.15
51 0.13
52 0.13
53 0.1
54 0.07
55 0.08
56 0.06
57 0.06
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.07
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.09
70 0.08
71 0.06
72 0.07
73 0.07
74 0.08
75 0.1
76 0.11
77 0.11
78 0.13
79 0.15
80 0.18
81 0.17
82 0.21
83 0.2
84 0.22
85 0.2
86 0.2
87 0.18
88 0.15
89 0.19
90 0.2
91 0.19
92 0.2
93 0.27
94 0.26
95 0.28
96 0.29
97 0.28
98 0.26
99 0.29
100 0.34
101 0.31
102 0.31
103 0.3
104 0.31
105 0.28