Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MLM1

Protein Details
Accession A0A1C7MLM1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALQFVLIVIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.89
12 0.86
13 0.87
14 0.86
15 0.82
16 0.76
17 0.7
18 0.61
19 0.55
20 0.52
21 0.51
22 0.51
23 0.49
24 0.49
25 0.5
26 0.53
27 0.56
28 0.58
29 0.53
30 0.53
31 0.58
32 0.59
33 0.62
34 0.6
35 0.59
36 0.58
37 0.6
38 0.51
39 0.46
40 0.42
41 0.34
42 0.36
43 0.37
44 0.35
45 0.3
46 0.36
47 0.4
48 0.48
49 0.57
50 0.6
51 0.59
52 0.63
53 0.7
54 0.71
55 0.69
56 0.65
57 0.6
58 0.57
59 0.55
60 0.5
61 0.45
62 0.42
63 0.37
64 0.31
65 0.29
66 0.29
67 0.33
68 0.39
69 0.43
70 0.46
71 0.56
72 0.63
73 0.68
74 0.65
75 0.6
76 0.56
77 0.51
78 0.51
79 0.51
80 0.51
81 0.52
82 0.55
83 0.52
84 0.48
85 0.47
86 0.4
87 0.32
88 0.28
89 0.26
90 0.24
91 0.25
92 0.24