Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MU12

Protein Details
Accession A0A1C7MU12   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
312-332FERGGHRPATKKNDRRKLLLEBasic
NLS Segment(s)
PositionSequence
321-323TKK
Subcellular Location(s) mito 14, cyto 8, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
Amino Acid Sequences MMSDRPSPFATVPRSVLQHVVDVHCHPTDSDTPPGLLAALPIRLCAMATRQNDQPLVRALAHAHPDKIVPCFGYHPWFAHWIALAPVASKAEHYRALFLDAPTPTADLVAAFDRLLPYLPDPIILAEVLAGLRADLTTFPSAMLGEVGLDRACRIPYASPECPPYSAAEADTPRALSPFTIPLAHQLAVLEAQLALAAELGRNVSMHSVKCQQSWHQIEKKHTNVFLSLSTVINARSPAHKALITACSPHRILVESDFHDVQYSAERTWEMLLIIAEVKGWHVEESWDEDYEKAGEERWGAVRRLEENWKAFERGGHRPATKKNDRRKLLLEEWESDEGDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.4
4 0.33
5 0.32
6 0.31
7 0.3
8 0.28
9 0.27
10 0.29
11 0.26
12 0.25
13 0.21
14 0.22
15 0.25
16 0.26
17 0.3
18 0.27
19 0.27
20 0.27
21 0.27
22 0.22
23 0.17
24 0.14
25 0.1
26 0.12
27 0.12
28 0.12
29 0.12
30 0.12
31 0.12
32 0.12
33 0.15
34 0.2
35 0.23
36 0.26
37 0.3
38 0.34
39 0.37
40 0.36
41 0.34
42 0.3
43 0.31
44 0.28
45 0.25
46 0.23
47 0.25
48 0.31
49 0.3
50 0.26
51 0.23
52 0.25
53 0.25
54 0.25
55 0.22
56 0.16
57 0.15
58 0.18
59 0.2
60 0.22
61 0.22
62 0.22
63 0.22
64 0.25
65 0.24
66 0.22
67 0.2
68 0.16
69 0.15
70 0.15
71 0.13
72 0.1
73 0.11
74 0.1
75 0.1
76 0.1
77 0.12
78 0.13
79 0.18
80 0.17
81 0.19
82 0.19
83 0.23
84 0.24
85 0.22
86 0.24
87 0.2
88 0.21
89 0.18
90 0.18
91 0.14
92 0.11
93 0.11
94 0.06
95 0.07
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.07
104 0.07
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.07
113 0.04
114 0.05
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.06
142 0.07
143 0.13
144 0.2
145 0.22
146 0.23
147 0.26
148 0.27
149 0.27
150 0.26
151 0.22
152 0.16
153 0.15
154 0.14
155 0.14
156 0.14
157 0.14
158 0.13
159 0.12
160 0.1
161 0.1
162 0.09
163 0.06
164 0.07
165 0.08
166 0.08
167 0.09
168 0.09
169 0.12
170 0.14
171 0.14
172 0.13
173 0.11
174 0.1
175 0.1
176 0.1
177 0.07
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.06
192 0.09
193 0.09
194 0.12
195 0.19
196 0.21
197 0.22
198 0.25
199 0.26
200 0.33
201 0.39
202 0.44
203 0.43
204 0.47
205 0.53
206 0.59
207 0.61
208 0.56
209 0.51
210 0.43
211 0.39
212 0.36
213 0.29
214 0.23
215 0.19
216 0.14
217 0.14
218 0.13
219 0.12
220 0.12
221 0.12
222 0.1
223 0.12
224 0.14
225 0.16
226 0.17
227 0.18
228 0.17
229 0.2
230 0.23
231 0.22
232 0.22
233 0.22
234 0.23
235 0.23
236 0.23
237 0.2
238 0.18
239 0.18
240 0.19
241 0.24
242 0.22
243 0.26
244 0.25
245 0.24
246 0.23
247 0.21
248 0.17
249 0.18
250 0.18
251 0.14
252 0.15
253 0.15
254 0.15
255 0.16
256 0.16
257 0.09
258 0.09
259 0.09
260 0.09
261 0.09
262 0.08
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.07
270 0.08
271 0.1
272 0.16
273 0.18
274 0.18
275 0.18
276 0.18
277 0.19
278 0.18
279 0.18
280 0.12
281 0.11
282 0.11
283 0.12
284 0.15
285 0.2
286 0.24
287 0.24
288 0.26
289 0.29
290 0.3
291 0.34
292 0.4
293 0.4
294 0.39
295 0.44
296 0.45
297 0.43
298 0.41
299 0.41
300 0.38
301 0.41
302 0.43
303 0.45
304 0.46
305 0.51
306 0.6
307 0.65
308 0.7
309 0.71
310 0.76
311 0.79
312 0.8
313 0.81
314 0.79
315 0.77
316 0.74
317 0.74
318 0.68
319 0.62
320 0.61
321 0.57
322 0.5