Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M516

Protein Details
Accession A0A1C7M516    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-87HIPMPLGTGKKKRKKTKHRAASAAYHBasic
NLS Segment(s)
PositionSequence
70-80GKKKRKKTKHR
Subcellular Location(s) mito 13, extr 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR044285  PWP1  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MAQLSSRLLPFLPLVRNLHTCAFGNYIAVGTLDPEIEIWSLDVVEAMYPDMILGRPDKTAAHIPMPLGTGKKKRKKTKHRAASAAYHVDAILSLSWNKTHRNLLASASADRTVKLWDLTRDPTINGDGGENEGALRSFNVHKDKVQAVQWNETEPTVLLTGSYDRTVRTFDSRAPDAGVGAVVGADVEALRWDPWEAHGFYVSLENGLVLNFDAQDADLGKRQVSLVTSRDLGVGKVFSTYGHQMTHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.35
4 0.36
5 0.36
6 0.33
7 0.3
8 0.28
9 0.28
10 0.23
11 0.21
12 0.18
13 0.16
14 0.13
15 0.12
16 0.09
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.13
46 0.19
47 0.21
48 0.22
49 0.22
50 0.22
51 0.23
52 0.24
53 0.22
54 0.18
55 0.21
56 0.28
57 0.37
58 0.46
59 0.55
60 0.64
61 0.74
62 0.83
63 0.89
64 0.9
65 0.91
66 0.9
67 0.88
68 0.82
69 0.78
70 0.72
71 0.64
72 0.52
73 0.42
74 0.32
75 0.25
76 0.2
77 0.13
78 0.08
79 0.05
80 0.05
81 0.06
82 0.08
83 0.1
84 0.12
85 0.14
86 0.18
87 0.19
88 0.21
89 0.22
90 0.21
91 0.23
92 0.23
93 0.21
94 0.18
95 0.18
96 0.15
97 0.14
98 0.13
99 0.1
100 0.1
101 0.1
102 0.11
103 0.12
104 0.14
105 0.17
106 0.18
107 0.18
108 0.17
109 0.17
110 0.16
111 0.14
112 0.11
113 0.09
114 0.07
115 0.07
116 0.07
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.11
126 0.16
127 0.17
128 0.18
129 0.21
130 0.23
131 0.24
132 0.27
133 0.28
134 0.26
135 0.3
136 0.3
137 0.28
138 0.27
139 0.23
140 0.2
141 0.14
142 0.13
143 0.08
144 0.07
145 0.06
146 0.06
147 0.07
148 0.08
149 0.09
150 0.08
151 0.08
152 0.09
153 0.11
154 0.12
155 0.16
156 0.16
157 0.19
158 0.25
159 0.26
160 0.26
161 0.26
162 0.24
163 0.19
164 0.18
165 0.14
166 0.08
167 0.06
168 0.05
169 0.03
170 0.03
171 0.02
172 0.02
173 0.02
174 0.02
175 0.03
176 0.04
177 0.04
178 0.05
179 0.06
180 0.06
181 0.09
182 0.14
183 0.15
184 0.15
185 0.16
186 0.16
187 0.16
188 0.18
189 0.16
190 0.11
191 0.1
192 0.09
193 0.08
194 0.08
195 0.08
196 0.05
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.07
203 0.08
204 0.1
205 0.13
206 0.14
207 0.14
208 0.15
209 0.15
210 0.16
211 0.17
212 0.2
213 0.18
214 0.21
215 0.22
216 0.22
217 0.24
218 0.23
219 0.21
220 0.18
221 0.17
222 0.13
223 0.13
224 0.13
225 0.11
226 0.16
227 0.19
228 0.2
229 0.2