Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MBF5

Protein Details
Accession A0A1C7MBF5   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
4-30HDDDSSAKPPKKRQRKPVDNVQHPKSIHydrophilic
84-124SVLIDEPRKRKRKKKGDNEKSKEPKEKRKKATKELSKDEETBasic
NLS Segment(s)
PositionSequence
11-19KPPKKRQRK
90-116PRKRKRKKKGDNEKSKEPKEKRKKATK
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MKDHDDDSSAKPPKKRQRKPVDNVQHPKSIETAAVKAKDDPLSMNEAGNQSRTSVDAIVPEKNADGIPQAGSEAPEEKSESEMSVLIDEPRKRKRKKKGDNEKSKEPKEKRKKATKELSKDEETLKRLKSLVVACGVRKVWAKEFKNLETPSEQIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.78
4 0.82
5 0.88
6 0.9
7 0.91
8 0.92
9 0.91
10 0.9
11 0.83
12 0.78
13 0.68
14 0.6
15 0.5
16 0.4
17 0.32
18 0.25
19 0.25
20 0.24
21 0.25
22 0.25
23 0.24
24 0.27
25 0.26
26 0.24
27 0.21
28 0.18
29 0.21
30 0.21
31 0.2
32 0.18
33 0.19
34 0.19
35 0.19
36 0.17
37 0.12
38 0.12
39 0.12
40 0.11
41 0.1
42 0.09
43 0.12
44 0.14
45 0.14
46 0.14
47 0.14
48 0.13
49 0.13
50 0.12
51 0.08
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.1
66 0.09
67 0.09
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.12
75 0.14
76 0.19
77 0.28
78 0.38
79 0.45
80 0.54
81 0.64
82 0.71
83 0.8
84 0.85
85 0.88
86 0.89
87 0.93
88 0.92
89 0.92
90 0.9
91 0.86
92 0.84
93 0.8
94 0.8
95 0.8
96 0.83
97 0.82
98 0.84
99 0.86
100 0.86
101 0.89
102 0.88
103 0.87
104 0.85
105 0.82
106 0.74
107 0.68
108 0.63
109 0.58
110 0.51
111 0.47
112 0.39
113 0.35
114 0.32
115 0.3
116 0.3
117 0.27
118 0.27
119 0.29
120 0.3
121 0.28
122 0.33
123 0.32
124 0.3
125 0.32
126 0.33
127 0.35
128 0.42
129 0.45
130 0.49
131 0.55
132 0.56
133 0.61
134 0.58
135 0.53
136 0.46