Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZHE4

Protein Details
Accession C7ZHE4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
276-299EGLLWKGKKRPLGQRSRRCPTWSWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 5, cyto 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
KEGG nhe:NECHADRAFT_25592  -  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences ALRRETLDTDLECLARDVIRPWVDNCDAAKNWHQDCQPVTTRNPDYFPTRLIDVGTCQEDIVRLVVTSEDILKATEPPKYLTLSYCWGQSNSPAKTTPQNYEKRRVNIDTESLPRTIQDAIRLTRVMKIRYLWVDALCIIQNLEDFYMEATKMEAYYAGGYCLISATGFSDSSEGLFPDRPIENNLTKTSQAPKEKPPNFDYSALRILHTGYERVMDSPSLLCMWLAWKELIPRYLRMELSYEDDRLTAIQALGHLLAKKHGDRYFGGIFRSYLAEGLLWKGKKRPLGQRSRRCPTWSWGVAKSVEFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.15
4 0.14
5 0.2
6 0.23
7 0.25
8 0.25
9 0.31
10 0.32
11 0.35
12 0.35
13 0.34
14 0.31
15 0.34
16 0.4
17 0.4
18 0.4
19 0.43
20 0.42
21 0.4
22 0.41
23 0.44
24 0.44
25 0.41
26 0.42
27 0.45
28 0.49
29 0.47
30 0.47
31 0.43
32 0.4
33 0.38
34 0.37
35 0.31
36 0.28
37 0.25
38 0.24
39 0.22
40 0.19
41 0.21
42 0.2
43 0.18
44 0.16
45 0.15
46 0.15
47 0.14
48 0.13
49 0.09
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.11
61 0.12
62 0.15
63 0.15
64 0.17
65 0.19
66 0.21
67 0.22
68 0.2
69 0.22
70 0.23
71 0.23
72 0.23
73 0.23
74 0.21
75 0.2
76 0.26
77 0.31
78 0.28
79 0.3
80 0.28
81 0.28
82 0.35
83 0.38
84 0.38
85 0.39
86 0.47
87 0.49
88 0.58
89 0.63
90 0.6
91 0.62
92 0.58
93 0.53
94 0.46
95 0.45
96 0.39
97 0.36
98 0.33
99 0.28
100 0.25
101 0.21
102 0.19
103 0.18
104 0.14
105 0.15
106 0.18
107 0.18
108 0.21
109 0.21
110 0.2
111 0.23
112 0.26
113 0.23
114 0.2
115 0.2
116 0.22
117 0.23
118 0.25
119 0.21
120 0.17
121 0.17
122 0.15
123 0.15
124 0.11
125 0.09
126 0.07
127 0.06
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.03
152 0.03
153 0.04
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.06
162 0.06
163 0.07
164 0.07
165 0.1
166 0.1
167 0.11
168 0.13
169 0.18
170 0.19
171 0.22
172 0.24
173 0.23
174 0.23
175 0.24
176 0.28
177 0.31
178 0.35
179 0.35
180 0.42
181 0.51
182 0.56
183 0.59
184 0.56
185 0.56
186 0.52
187 0.53
188 0.46
189 0.4
190 0.41
191 0.36
192 0.33
193 0.26
194 0.23
195 0.21
196 0.2
197 0.16
198 0.1
199 0.12
200 0.12
201 0.13
202 0.13
203 0.1
204 0.1
205 0.09
206 0.1
207 0.08
208 0.08
209 0.07
210 0.06
211 0.08
212 0.09
213 0.11
214 0.1
215 0.11
216 0.15
217 0.18
218 0.23
219 0.23
220 0.24
221 0.27
222 0.31
223 0.3
224 0.28
225 0.28
226 0.24
227 0.28
228 0.28
229 0.24
230 0.2
231 0.19
232 0.18
233 0.16
234 0.15
235 0.1
236 0.08
237 0.08
238 0.08
239 0.09
240 0.1
241 0.12
242 0.12
243 0.11
244 0.14
245 0.18
246 0.2
247 0.26
248 0.28
249 0.29
250 0.29
251 0.35
252 0.39
253 0.37
254 0.37
255 0.31
256 0.29
257 0.27
258 0.28
259 0.22
260 0.15
261 0.13
262 0.12
263 0.11
264 0.14
265 0.2
266 0.19
267 0.22
268 0.27
269 0.32
270 0.39
271 0.46
272 0.53
273 0.57
274 0.67
275 0.76
276 0.81
277 0.87
278 0.88
279 0.87
280 0.81
281 0.75
282 0.7
283 0.7
284 0.66
285 0.62
286 0.56
287 0.54
288 0.52