Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LQF9

Protein Details
Accession A0A1C7LQF9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPLHSLCRLRRRYHIRRQIPNRLAPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPLHSLCRLRRRYHIRRQIPNRLAPTRSGEPTNLERISYAHAAPSVTMGSKELHPAASHIYDSPAFDCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.85
4 0.89
5 0.9
6 0.85
7 0.82
8 0.79
9 0.72
10 0.63
11 0.55
12 0.52
13 0.45
14 0.41
15 0.35
16 0.28
17 0.27
18 0.29
19 0.32
20 0.25
21 0.21
22 0.19
23 0.18
24 0.21
25 0.18
26 0.15
27 0.1
28 0.1
29 0.1
30 0.1
31 0.11
32 0.08
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.12
39 0.12
40 0.13
41 0.13
42 0.14
43 0.17
44 0.17
45 0.17
46 0.15
47 0.18
48 0.18
49 0.19