Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MHW8

Protein Details
Accession A0A1C7MHW8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-67RCRECGHRIMYKKRTKRMVQFEARHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MSSNFSNPGPGQQSGFAPPPRQEMEYLCADCGAKNEIRSREPIRCRECGHRIMYKKRTKRMVQFEAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.27
4 0.26
5 0.26
6 0.3
7 0.3
8 0.3
9 0.27
10 0.24
11 0.25
12 0.27
13 0.26
14 0.21
15 0.19
16 0.18
17 0.17
18 0.16
19 0.14
20 0.1
21 0.12
22 0.17
23 0.2
24 0.21
25 0.26
26 0.29
27 0.35
28 0.4
29 0.47
30 0.47
31 0.49
32 0.52
33 0.55
34 0.57
35 0.55
36 0.54
37 0.53
38 0.57
39 0.62
40 0.69
41 0.71
42 0.73
43 0.76
44 0.8
45 0.81
46 0.83
47 0.83