Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LZT4

Protein Details
Accession A0A1C7LZT4   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-125DLVRWHVLNRPKPKPKPPASQPPPPGTHydrophilic
NLS Segment(s)
PositionSequence
110-114KPKPK
Subcellular Location(s) cyto_nucl 13, cyto 12, nucl 10, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDNGVEVIDFNTRFSGITPEIYENAILPLASVRKSLDDFIDSETIIIGHALENDLKTLRMIHHRRALKALAKEILGKTIQSGGAMVGHSSVEDSIATLDLVRWHVLNRPKPKPKPPASQPPPPGTSSVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.14
4 0.17
5 0.19
6 0.2
7 0.21
8 0.21
9 0.21
10 0.15
11 0.14
12 0.12
13 0.09
14 0.07
15 0.08
16 0.09
17 0.1
18 0.1
19 0.1
20 0.12
21 0.14
22 0.15
23 0.14
24 0.14
25 0.14
26 0.16
27 0.16
28 0.14
29 0.13
30 0.11
31 0.1
32 0.08
33 0.07
34 0.04
35 0.03
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.18
47 0.21
48 0.26
49 0.33
50 0.36
51 0.36
52 0.38
53 0.4
54 0.35
55 0.34
56 0.31
57 0.25
58 0.23
59 0.25
60 0.22
61 0.21
62 0.16
63 0.13
64 0.11
65 0.12
66 0.11
67 0.09
68 0.09
69 0.06
70 0.07
71 0.07
72 0.07
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.07
87 0.09
88 0.09
89 0.09
90 0.09
91 0.16
92 0.25
93 0.33
94 0.41
95 0.5
96 0.6
97 0.69
98 0.78
99 0.82
100 0.83
101 0.85
102 0.85
103 0.86
104 0.83
105 0.84
106 0.82
107 0.79
108 0.74
109 0.64