Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MN81

Protein Details
Accession A0A1C7MN81    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-70MLSRLPSRNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSWVGPAKGRAKRNNRNAGHydrophilic
NLS Segment(s)
PositionSequence
8-70RNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSWVGPAKGRAKRNNRNAG
Subcellular Location(s) nucl 19, mito_nucl 12.999, cyto_nucl 12.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLSRLPSRNLRPPPKQKESRPSRRARVRAARSPPPKPRRRRATHPTLRRSRTSWVGPAKGRAKRNNRNAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.85
4 0.86
5 0.87
6 0.88
7 0.87
8 0.86
9 0.85
10 0.86
11 0.83
12 0.82
13 0.81
14 0.78
15 0.77
16 0.75
17 0.74
18 0.71
19 0.73
20 0.73
21 0.73
22 0.74
23 0.75
24 0.78
25 0.79
26 0.8
27 0.82
28 0.81
29 0.83
30 0.84
31 0.85
32 0.85
33 0.84
34 0.81
35 0.75
36 0.68
37 0.62
38 0.59
39 0.54
40 0.52
41 0.5
42 0.52
43 0.5
44 0.56
45 0.59
46 0.59
47 0.63
48 0.65
49 0.68
50 0.72