Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MA91

Protein Details
Accession A0A1C7MA91    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-55DAFQCGRCKQRKCRYRHAQTRSADHydrophilic
102-121ISAAQRVNWRRKFRQCTFVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS51133  ZF_TFIIS_2  
CDD cd13749  Zn-ribbon_TFIIS  
Amino Acid Sequences MASEEHKAADQKIAQENLFKTLGAEEVQAETDAFQCGRCKQRKCRYRHAQTRSADEPMTAFVTCTVCNNSNRGGSISPSKPTSSSSSFRRTLANSHIGSSAISAAQRVNWRRKFRQCTFVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.34
5 0.32
6 0.26
7 0.2
8 0.17
9 0.18
10 0.13
11 0.13
12 0.09
13 0.09
14 0.1
15 0.1
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.15
24 0.24
25 0.32
26 0.39
27 0.49
28 0.59
29 0.67
30 0.72
31 0.79
32 0.8
33 0.84
34 0.86
35 0.83
36 0.81
37 0.75
38 0.74
39 0.65
40 0.56
41 0.45
42 0.35
43 0.27
44 0.2
45 0.18
46 0.11
47 0.08
48 0.07
49 0.08
50 0.08
51 0.09
52 0.11
53 0.13
54 0.14
55 0.16
56 0.17
57 0.17
58 0.18
59 0.18
60 0.16
61 0.15
62 0.21
63 0.21
64 0.21
65 0.22
66 0.22
67 0.21
68 0.23
69 0.27
70 0.26
71 0.29
72 0.33
73 0.38
74 0.39
75 0.4
76 0.41
77 0.37
78 0.36
79 0.37
80 0.39
81 0.33
82 0.32
83 0.32
84 0.29
85 0.27
86 0.23
87 0.17
88 0.1
89 0.1
90 0.09
91 0.08
92 0.12
93 0.2
94 0.27
95 0.37
96 0.45
97 0.54
98 0.63
99 0.73
100 0.8
101 0.79