Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7M456

Protein Details
Accession A0A1C7M456    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-44STDARPNPPKRARKAINCEPCRNSKLKCDRNRPCSSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MALSDDPSTDARPNPPKRARKAINCEPCRNSKLKCDRNRPCSSCVLRGTTAQCYQGQDADLALRGFDQHRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.64
4 0.69
5 0.78
6 0.78
7 0.78
8 0.81
9 0.81
10 0.82
11 0.8
12 0.78
13 0.71
14 0.69
15 0.63
16 0.56
17 0.48
18 0.47
19 0.51
20 0.54
21 0.6
22 0.65
23 0.69
24 0.75
25 0.82
26 0.76
27 0.68
28 0.68
29 0.62
30 0.58
31 0.52
32 0.47
33 0.39
34 0.39
35 0.38
36 0.34
37 0.33
38 0.28
39 0.27
40 0.26
41 0.26
42 0.24
43 0.22
44 0.17
45 0.15
46 0.14
47 0.14
48 0.12
49 0.11
50 0.09
51 0.1
52 0.13