Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LV26

Protein Details
Accession A0A1C7LV26   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-103IIPSSRVKRKHSSRAKLSSAKRRRVTKHydrophilic
NLS Segment(s)
PositionSequence
82-103RVKRKHSSRAKLSSAKRRRVTK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MARVDKPQQTSPPLGSPSGLQRDLNNDVINIDATYPNALPYPTANQDNSAQDAESETQSESAVDELEPTSKKLVEAIIPSSRVKRKHSSRAKLSSAKRRRVTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.3
4 0.31
5 0.34
6 0.32
7 0.27
8 0.25
9 0.3
10 0.34
11 0.35
12 0.28
13 0.21
14 0.19
15 0.19
16 0.18
17 0.13
18 0.1
19 0.07
20 0.07
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.07
27 0.08
28 0.12
29 0.14
30 0.16
31 0.16
32 0.17
33 0.2
34 0.21
35 0.21
36 0.17
37 0.14
38 0.11
39 0.12
40 0.11
41 0.09
42 0.09
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.05
49 0.05
50 0.04
51 0.05
52 0.05
53 0.08
54 0.08
55 0.09
56 0.1
57 0.1
58 0.11
59 0.11
60 0.12
61 0.12
62 0.14
63 0.18
64 0.2
65 0.22
66 0.24
67 0.3
68 0.34
69 0.36
70 0.4
71 0.46
72 0.52
73 0.6
74 0.7
75 0.74
76 0.78
77 0.82
78 0.85
79 0.84
80 0.84
81 0.84
82 0.83
83 0.83