Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MNI3

Protein Details
Accession A0A1C7MNI3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-87PEKRPAAVPVRPRPRKKPKANASBasic
NLS Segment(s)
PositionSequence
65-86PEKRPAAVPVRPRPRKKPKANA
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MFTDSVETGRAGNQQWGLDKGTHQNRWNPYVNLPSQWSYQPYEGSDSELQPGPEYSDTEVKPHIPEKRPAAVPVRPRPRKKPKANAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.23
4 0.23
5 0.21
6 0.22
7 0.27
8 0.33
9 0.38
10 0.39
11 0.43
12 0.46
13 0.51
14 0.54
15 0.47
16 0.42
17 0.43
18 0.4
19 0.36
20 0.34
21 0.3
22 0.26
23 0.26
24 0.25
25 0.2
26 0.2
27 0.19
28 0.17
29 0.18
30 0.16
31 0.19
32 0.18
33 0.16
34 0.16
35 0.17
36 0.16
37 0.13
38 0.13
39 0.11
40 0.1
41 0.11
42 0.11
43 0.16
44 0.16
45 0.18
46 0.19
47 0.18
48 0.2
49 0.24
50 0.3
51 0.3
52 0.36
53 0.4
54 0.46
55 0.47
56 0.49
57 0.5
58 0.48
59 0.53
60 0.57
61 0.63
62 0.65
63 0.71
64 0.78
65 0.83
66 0.88
67 0.89