Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MHM0

Protein Details
Accession A0A1C7MHM0   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-92KVKSQCPKVDKQEKKKTPKGRAKKRMLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
64-83PKVDKQEKKKTPKGRAKKRM
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGIPNVVCKREGTRGRQFPPHRTKKANAPAFGVSNRPPPPRQQENMGKVHGSLARAGKVKSQCPKVDKQEKKKTPKGRAKKRMLYNRRFVNVTTLPGGKRRMNANPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.7
4 0.71
5 0.72
6 0.76
7 0.78
8 0.75
9 0.72
10 0.72
11 0.72
12 0.77
13 0.74
14 0.64
15 0.58
16 0.52
17 0.49
18 0.46
19 0.38
20 0.3
21 0.3
22 0.32
23 0.32
24 0.31
25 0.34
26 0.42
27 0.46
28 0.47
29 0.48
30 0.53
31 0.55
32 0.58
33 0.53
34 0.44
35 0.36
36 0.36
37 0.29
38 0.2
39 0.16
40 0.13
41 0.15
42 0.16
43 0.17
44 0.19
45 0.21
46 0.26
47 0.3
48 0.35
49 0.36
50 0.4
51 0.47
52 0.52
53 0.6
54 0.64
55 0.68
56 0.73
57 0.78
58 0.83
59 0.85
60 0.85
61 0.85
62 0.86
63 0.87
64 0.87
65 0.88
66 0.89
67 0.89
68 0.9
69 0.9
70 0.9
71 0.88
72 0.86
73 0.84
74 0.77
75 0.7
76 0.6
77 0.57
78 0.49
79 0.44
80 0.38
81 0.33
82 0.31
83 0.34
84 0.39
85 0.34
86 0.36
87 0.39
88 0.44