Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AYK0

Protein Details
Accession G3AYK0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-29KLDYLSKYTDKKKKSSKKLASNIVTNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
KEGG cten:CANTEDRAFT_112739  -  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MGKLDYLSKYTDKKKKSSKKLASNIVTNNDTISSSHINEDLPTFGETKFKGFKRIDNQQLQPAVKTDNEQAAGSGQTETVYRDLTGKVVDISQIKASLKPSNRVVLNESKSEQSNEKAPKSFTVSKSDKMYNDMLKSRTNFEDPIKSYAKVDKLSYIKGVNIPNRFGIKAGIMWDGIDRSNGFEKLVMRKRSQMKSSSKAEVNEYEMDFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.81
4 0.85
5 0.85
6 0.87
7 0.91
8 0.91
9 0.86
10 0.83
11 0.77
12 0.71
13 0.62
14 0.51
15 0.42
16 0.32
17 0.27
18 0.2
19 0.19
20 0.16
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.17
27 0.14
28 0.12
29 0.12
30 0.12
31 0.11
32 0.15
33 0.15
34 0.19
35 0.25
36 0.24
37 0.32
38 0.33
39 0.4
40 0.44
41 0.54
42 0.58
43 0.59
44 0.61
45 0.58
46 0.62
47 0.55
48 0.48
49 0.39
50 0.32
51 0.25
52 0.24
53 0.2
54 0.17
55 0.18
56 0.17
57 0.16
58 0.15
59 0.14
60 0.13
61 0.11
62 0.07
63 0.06
64 0.07
65 0.08
66 0.08
67 0.08
68 0.07
69 0.08
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.09
77 0.09
78 0.1
79 0.09
80 0.11
81 0.11
82 0.13
83 0.15
84 0.18
85 0.2
86 0.23
87 0.24
88 0.27
89 0.27
90 0.27
91 0.29
92 0.3
93 0.3
94 0.28
95 0.27
96 0.24
97 0.23
98 0.24
99 0.22
100 0.16
101 0.21
102 0.24
103 0.25
104 0.26
105 0.26
106 0.26
107 0.32
108 0.37
109 0.32
110 0.37
111 0.37
112 0.39
113 0.43
114 0.44
115 0.37
116 0.34
117 0.36
118 0.31
119 0.32
120 0.32
121 0.3
122 0.3
123 0.31
124 0.31
125 0.3
126 0.28
127 0.27
128 0.26
129 0.32
130 0.31
131 0.35
132 0.34
133 0.32
134 0.31
135 0.33
136 0.35
137 0.29
138 0.27
139 0.29
140 0.29
141 0.3
142 0.32
143 0.28
144 0.25
145 0.28
146 0.33
147 0.32
148 0.33
149 0.33
150 0.34
151 0.35
152 0.33
153 0.29
154 0.24
155 0.19
156 0.18
157 0.18
158 0.15
159 0.13
160 0.13
161 0.13
162 0.13
163 0.12
164 0.12
165 0.1
166 0.13
167 0.17
168 0.17
169 0.17
170 0.18
171 0.22
172 0.3
173 0.39
174 0.41
175 0.4
176 0.48
177 0.57
178 0.63
179 0.66
180 0.65
181 0.65
182 0.68
183 0.71
184 0.71
185 0.66
186 0.6
187 0.59
188 0.53
189 0.48
190 0.45