Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LNR3

Protein Details
Accession A0A1C7LNR3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-41GLLHHERRRPKRPSTPPWMSBasic
NLS Segment(s)
PositionSequence
29-32RRPK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAAQSLKALRRIAFSVNALRAGLLHHERRRPKRPSTPPWMSLPCYYPHPYLFPHSAATRLPDRTTDHFGGRACNVTASVHPSIHPSRPTYPSSAALHKYYATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.3
5 0.26
6 0.24
7 0.21
8 0.18
9 0.2
10 0.2
11 0.26
12 0.3
13 0.38
14 0.48
15 0.57
16 0.65
17 0.66
18 0.7
19 0.73
20 0.78
21 0.8
22 0.8
23 0.79
24 0.73
25 0.72
26 0.67
27 0.58
28 0.5
29 0.42
30 0.34
31 0.31
32 0.31
33 0.25
34 0.23
35 0.22
36 0.21
37 0.23
38 0.23
39 0.19
40 0.18
41 0.17
42 0.17
43 0.16
44 0.18
45 0.17
46 0.17
47 0.17
48 0.17
49 0.21
50 0.24
51 0.3
52 0.29
53 0.27
54 0.29
55 0.29
56 0.28
57 0.25
58 0.23
59 0.17
60 0.15
61 0.15
62 0.13
63 0.14
64 0.16
65 0.17
66 0.16
67 0.16
68 0.21
69 0.24
70 0.28
71 0.3
72 0.3
73 0.33
74 0.38
75 0.41
76 0.4
77 0.4
78 0.41
79 0.42
80 0.45
81 0.43
82 0.41
83 0.39