Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YYZ5

Protein Details
Accession C7YYZ5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
107-135KTEKDTTKESTPKKPKKNRNPLHCPGAICHydrophilic
NLS Segment(s)
PositionSequence
119-123KKPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 16.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG nhe:NECHADRAFT_83856  -  
Amino Acid Sequences MDQQQHIDALLERYLGLLDEYTQLRKSLSQLQSNVYQNIARANFAGERGMRYGQDHYDERMQAIRLLDIEVDEKEIPSFSIIDAPIEEPEKEEGATSEGNDGESEEKTEKDTTKESTPKKPKKNRNPLHCPGAICSGSKEDHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.06
5 0.06
6 0.1
7 0.12
8 0.14
9 0.15
10 0.15
11 0.15
12 0.16
13 0.19
14 0.25
15 0.3
16 0.34
17 0.35
18 0.38
19 0.45
20 0.46
21 0.44
22 0.35
23 0.29
24 0.23
25 0.27
26 0.24
27 0.17
28 0.14
29 0.15
30 0.15
31 0.15
32 0.17
33 0.11
34 0.12
35 0.14
36 0.15
37 0.13
38 0.14
39 0.16
40 0.15
41 0.19
42 0.18
43 0.19
44 0.21
45 0.21
46 0.2
47 0.2
48 0.19
49 0.16
50 0.15
51 0.13
52 0.1
53 0.1
54 0.09
55 0.07
56 0.08
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.04
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.08
76 0.09
77 0.1
78 0.09
79 0.09
80 0.08
81 0.09
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.08
90 0.08
91 0.11
92 0.1
93 0.1
94 0.13
95 0.16
96 0.17
97 0.19
98 0.22
99 0.24
100 0.31
101 0.4
102 0.43
103 0.51
104 0.6
105 0.67
106 0.75
107 0.82
108 0.84
109 0.87
110 0.93
111 0.93
112 0.92
113 0.93
114 0.9
115 0.87
116 0.8
117 0.7
118 0.62
119 0.6
120 0.5
121 0.41
122 0.35
123 0.31