Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MRC2

Protein Details
Accession A0A1C7MRC2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-36PTPPRRQRSVPPRGSNRWRPREBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MASRNPGNSLLSPTPTPPRRQRSVPPRGSNRWRPRELDLSQAHEDNIAIGHKAALKNPNVSEEAKEHSAHVLEDLGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.45
4 0.47
5 0.53
6 0.55
7 0.6
8 0.67
9 0.68
10 0.75
11 0.76
12 0.76
13 0.76
14 0.79
15 0.82
16 0.82
17 0.82
18 0.8
19 0.73
20 0.67
21 0.64
22 0.63
23 0.55
24 0.53
25 0.44
26 0.41
27 0.39
28 0.36
29 0.31
30 0.23
31 0.22
32 0.13
33 0.12
34 0.06
35 0.05
36 0.05
37 0.06
38 0.09
39 0.1
40 0.13
41 0.17
42 0.19
43 0.24
44 0.24
45 0.27
46 0.27
47 0.27
48 0.27
49 0.24
50 0.27
51 0.26
52 0.26
53 0.23
54 0.23
55 0.22
56 0.2
57 0.18
58 0.16