Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LNI5

Protein Details
Accession A0A1C7LNI5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-35ILALHRQQITRHRRRRRSRAARLESSPHydrophilic
NLS Segment(s)
PositionSequence
19-29RHRRRRRSRAA
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Amino Acid Sequences MTVCVVKLILALHRQQITRHRRRRRSRAARLESSPAVTHPIQLLSKFMSAQPIVSLHRTGSRRALWPRHNGTSSRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.38
4 0.45
5 0.52
6 0.61
7 0.66
8 0.73
9 0.83
10 0.9
11 0.92
12 0.92
13 0.92
14 0.93
15 0.91
16 0.86
17 0.79
18 0.73
19 0.62
20 0.52
21 0.41
22 0.3
23 0.26
24 0.19
25 0.17
26 0.12
27 0.13
28 0.12
29 0.12
30 0.13
31 0.1
32 0.11
33 0.11
34 0.1
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.14
41 0.15
42 0.16
43 0.13
44 0.2
45 0.21
46 0.23
47 0.27
48 0.29
49 0.35
50 0.43
51 0.52
52 0.52
53 0.61
54 0.66
55 0.68
56 0.68
57 0.64