Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MJF2

Protein Details
Accession A0A1C7MJF2    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-35VMDKAEAKEKKREKKRKRKEREREFPLAYDBasic
NLS Segment(s)
PositionSequence
12-28AKEKKREKKRKRKERER
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MREADVMDKAEAKEKKREKKRKRKEREREFPLAYDWGSLPQGDDLNDEGDVAVGPTIAPLSDDGGYVSPEFDFPSDSEDERSDQPPPPTKRTRLSAGNKHDKRVGATTLAEEEELALQMLRRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.64
4 0.75
5 0.78
6 0.85
7 0.93
8 0.94
9 0.96
10 0.96
11 0.96
12 0.97
13 0.96
14 0.93
15 0.91
16 0.82
17 0.72
18 0.63
19 0.54
20 0.42
21 0.33
22 0.24
23 0.17
24 0.14
25 0.13
26 0.11
27 0.1
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.03
41 0.02
42 0.02
43 0.03
44 0.02
45 0.03
46 0.03
47 0.04
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.05
61 0.09
62 0.1
63 0.11
64 0.12
65 0.13
66 0.15
67 0.17
68 0.18
69 0.17
70 0.2
71 0.24
72 0.32
73 0.37
74 0.43
75 0.48
76 0.53
77 0.57
78 0.58
79 0.59
80 0.6
81 0.64
82 0.65
83 0.68
84 0.74
85 0.7
86 0.68
87 0.66
88 0.58
89 0.52
90 0.47
91 0.39
92 0.31
93 0.3
94 0.28
95 0.26
96 0.25
97 0.21
98 0.16
99 0.14
100 0.11
101 0.1
102 0.09
103 0.07
104 0.08