Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LWT9

Protein Details
Accession A0A1C7LWT9   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-59SSSRKRSRENETPSQRHKREKAAERQRRKRERDRQAGLNBasic
NLS Segment(s)
PositionSequence
24-53RKRSRENETPSQRHKREKAAERQRRKRERD
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDPNTHHHDPSHQNVVPATPSSSRKRSRENETPSQRHKREKAAERQRRKRERDRQAGLNTILALSQVQPGPLKWSPRYKYRRASPSTKVTIPPPRML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.35
4 0.29
5 0.25
6 0.21
7 0.26
8 0.31
9 0.39
10 0.45
11 0.48
12 0.57
13 0.61
14 0.65
15 0.69
16 0.71
17 0.73
18 0.75
19 0.78
20 0.77
21 0.8
22 0.76
23 0.75
24 0.7
25 0.69
26 0.68
27 0.69
28 0.71
29 0.72
30 0.78
31 0.8
32 0.86
33 0.87
34 0.87
35 0.86
36 0.86
37 0.85
38 0.86
39 0.85
40 0.81
41 0.78
42 0.72
43 0.68
44 0.58
45 0.48
46 0.38
47 0.27
48 0.21
49 0.13
50 0.1
51 0.06
52 0.08
53 0.07
54 0.08
55 0.09
56 0.09
57 0.16
58 0.19
59 0.24
60 0.27
61 0.37
62 0.4
63 0.5
64 0.58
65 0.6
66 0.67
67 0.71
68 0.76
69 0.74
70 0.77
71 0.75
72 0.77
73 0.76
74 0.69
75 0.63
76 0.61
77 0.64