Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LRX5

Protein Details
Accession A0A1C7LRX5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-102LKEPPRGQTRPMKKPRRAMABasic
NLS Segment(s)
PositionSequence
87-100PRGQTRPMKKPRRA
Subcellular Location(s) cyto 11.5, nucl 9, cyto_pero 6.5, mito 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MTPPGSLQTPIQTTIMGNEVDDPFLDFEPIDKNHFTNTPLVESPTSLEREDLNPVPPSLSFEEWMGGITEGATGPGVPGGDPLKEPPRGQTRPMKKPRRAMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.14
4 0.12
5 0.13
6 0.13
7 0.13
8 0.13
9 0.12
10 0.11
11 0.11
12 0.11
13 0.07
14 0.08
15 0.12
16 0.14
17 0.16
18 0.15
19 0.15
20 0.17
21 0.19
22 0.19
23 0.18
24 0.18
25 0.18
26 0.18
27 0.19
28 0.17
29 0.16
30 0.16
31 0.15
32 0.15
33 0.12
34 0.12
35 0.11
36 0.12
37 0.16
38 0.15
39 0.15
40 0.14
41 0.13
42 0.13
43 0.12
44 0.14
45 0.14
46 0.14
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.09
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.04
65 0.06
66 0.07
67 0.08
68 0.09
69 0.14
70 0.19
71 0.23
72 0.23
73 0.29
74 0.38
75 0.41
76 0.46
77 0.53
78 0.58
79 0.65
80 0.76
81 0.78
82 0.77