Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LT00

Protein Details
Accession A0A1C7LT00    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
162-184KQLKAVMPDRRRRRRGRSFLTSIHydrophilic
NLS Segment(s)
PositionSequence
171-177RRRRRRG
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008862  Tcp11  
Pfam View protein in Pfam  
PF05794  Tcp11  
Amino Acid Sequences MLSSPSSQPDEDDEEAPTLKHRVQDLVHRAFWDEAKETLSNPAPSAQLPRLQRFYEDLYVALKPLLPSGHPILVTLSSPMSPTSSPLRLAVSHLREILACLRERCAPVRDARIDGLVRDLDEASTSSHLEEVVVSTVRSLLDLADLMKEDLSQFTLGQMSEKQLKAVMPDRRRRRRGRSFLTSIYVPGLGCGIGSELFVDSQTGSSSGVDRPYILSSTHKDGIVGTTGIDNSSGTEHSPPPFFFDCPALLYTQNILQALVIAASLRSLVRLPTPQPQDHTPNFTARIWTLLTAEINEEPGAGDTKLVNLADEVVRVRRVFSACDAEEEARLRAAVDRTLQPRDPVFLLLQTRLLRALAVRLCEVRDVGGPSAPVRLEAGLDRPGKRPRLMLPVEAECGGTDGGTGGAGEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.23
5 0.19
6 0.19
7 0.22
8 0.22
9 0.26
10 0.28
11 0.38
12 0.46
13 0.49
14 0.49
15 0.45
16 0.46
17 0.43
18 0.41
19 0.35
20 0.28
21 0.22
22 0.23
23 0.23
24 0.22
25 0.26
26 0.29
27 0.26
28 0.25
29 0.26
30 0.24
31 0.24
32 0.3
33 0.27
34 0.28
35 0.33
36 0.39
37 0.42
38 0.41
39 0.42
40 0.4
41 0.42
42 0.4
43 0.35
44 0.29
45 0.26
46 0.25
47 0.24
48 0.2
49 0.16
50 0.11
51 0.13
52 0.13
53 0.11
54 0.15
55 0.19
56 0.21
57 0.2
58 0.2
59 0.2
60 0.2
61 0.19
62 0.16
63 0.13
64 0.1
65 0.11
66 0.11
67 0.11
68 0.1
69 0.13
70 0.18
71 0.19
72 0.2
73 0.21
74 0.23
75 0.21
76 0.26
77 0.31
78 0.29
79 0.29
80 0.29
81 0.28
82 0.25
83 0.27
84 0.27
85 0.23
86 0.22
87 0.2
88 0.22
89 0.25
90 0.27
91 0.29
92 0.28
93 0.27
94 0.3
95 0.37
96 0.38
97 0.37
98 0.35
99 0.36
100 0.32
101 0.29
102 0.26
103 0.18
104 0.16
105 0.15
106 0.14
107 0.09
108 0.1
109 0.1
110 0.08
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.07
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.09
145 0.09
146 0.11
147 0.16
148 0.16
149 0.15
150 0.16
151 0.16
152 0.18
153 0.25
154 0.31
155 0.34
156 0.43
157 0.54
158 0.63
159 0.72
160 0.77
161 0.8
162 0.83
163 0.84
164 0.84
165 0.82
166 0.78
167 0.71
168 0.66
169 0.56
170 0.45
171 0.35
172 0.27
173 0.17
174 0.12
175 0.09
176 0.06
177 0.05
178 0.04
179 0.04
180 0.03
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.07
195 0.08
196 0.08
197 0.08
198 0.09
199 0.09
200 0.1
201 0.09
202 0.11
203 0.13
204 0.18
205 0.19
206 0.18
207 0.17
208 0.16
209 0.17
210 0.15
211 0.13
212 0.08
213 0.07
214 0.07
215 0.07
216 0.07
217 0.06
218 0.05
219 0.06
220 0.06
221 0.06
222 0.08
223 0.1
224 0.11
225 0.13
226 0.13
227 0.18
228 0.19
229 0.19
230 0.17
231 0.18
232 0.17
233 0.17
234 0.17
235 0.13
236 0.12
237 0.12
238 0.11
239 0.11
240 0.12
241 0.1
242 0.1
243 0.08
244 0.08
245 0.08
246 0.07
247 0.05
248 0.03
249 0.03
250 0.03
251 0.04
252 0.03
253 0.04
254 0.05
255 0.05
256 0.08
257 0.11
258 0.14
259 0.22
260 0.28
261 0.29
262 0.32
263 0.36
264 0.42
265 0.41
266 0.46
267 0.4
268 0.38
269 0.39
270 0.36
271 0.33
272 0.26
273 0.26
274 0.19
275 0.18
276 0.15
277 0.13
278 0.13
279 0.11
280 0.13
281 0.1
282 0.11
283 0.1
284 0.09
285 0.07
286 0.08
287 0.09
288 0.07
289 0.08
290 0.07
291 0.08
292 0.11
293 0.1
294 0.09
295 0.08
296 0.1
297 0.1
298 0.11
299 0.11
300 0.11
301 0.14
302 0.14
303 0.15
304 0.18
305 0.18
306 0.19
307 0.22
308 0.27
309 0.25
310 0.28
311 0.3
312 0.26
313 0.27
314 0.27
315 0.24
316 0.17
317 0.16
318 0.14
319 0.15
320 0.16
321 0.16
322 0.18
323 0.24
324 0.28
325 0.34
326 0.35
327 0.34
328 0.33
329 0.34
330 0.31
331 0.27
332 0.24
333 0.23
334 0.25
335 0.23
336 0.27
337 0.25
338 0.24
339 0.23
340 0.22
341 0.17
342 0.15
343 0.21
344 0.18
345 0.2
346 0.21
347 0.22
348 0.22
349 0.23
350 0.23
351 0.17
352 0.18
353 0.19
354 0.18
355 0.18
356 0.18
357 0.18
358 0.21
359 0.19
360 0.17
361 0.15
362 0.14
363 0.13
364 0.14
365 0.17
366 0.21
367 0.27
368 0.29
369 0.34
370 0.42
371 0.46
372 0.47
373 0.48
374 0.47
375 0.52
376 0.54
377 0.52
378 0.51
379 0.5
380 0.5
381 0.45
382 0.39
383 0.28
384 0.26
385 0.2
386 0.13
387 0.09
388 0.07
389 0.06
390 0.06
391 0.06