Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MP49

Protein Details
Accession A0A1C7MP49    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-66SEGRCREGKVKKEQKKSRVQHTDVBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRAKLLSNLQALQRRNSNPVAATFSPVCRRLWSCFRQPDYQGSEGRCREGKVKKEQKKSRVQHTDVRNTSSEAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.42
4 0.38
5 0.33
6 0.33
7 0.35
8 0.28
9 0.29
10 0.25
11 0.26
12 0.28
13 0.28
14 0.27
15 0.23
16 0.25
17 0.27
18 0.34
19 0.36
20 0.39
21 0.45
22 0.49
23 0.49
24 0.49
25 0.49
26 0.46
27 0.44
28 0.39
29 0.34
30 0.37
31 0.34
32 0.35
33 0.3
34 0.27
35 0.31
36 0.35
37 0.4
38 0.45
39 0.55
40 0.61
41 0.71
42 0.79
43 0.81
44 0.85
45 0.85
46 0.85
47 0.84
48 0.8
49 0.77
50 0.78
51 0.79
52 0.72
53 0.69
54 0.6