Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7M6B7

Protein Details
Accession A0A1C7M6B7    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-94LKSDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, pero 5, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MSALFLPLDESVGLAELTGVICVKIAFPEDFPHEAHPREGVAPESVSRGLESMCDASLKDVCESPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.08
14 0.09
15 0.12
16 0.16
17 0.17
18 0.18
19 0.22
20 0.23
21 0.23
22 0.23
23 0.2
24 0.17
25 0.16
26 0.16
27 0.12
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.08
35 0.07
36 0.06
37 0.06
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.09
45 0.1
46 0.09
47 0.09
48 0.1
49 0.13
50 0.14
51 0.14
52 0.2
53 0.22
54 0.23
55 0.29
56 0.29
57 0.3
58 0.36
59 0.39
60 0.35
61 0.43
62 0.49
63 0.47
64 0.54
65 0.59
66 0.63
67 0.68
68 0.73
69 0.74
70 0.77
71 0.79
72 0.82
73 0.85
74 0.85