Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M8G6

Protein Details
Accession A0A1C7M8G6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-127ESERHEKSRVNRRKARKRTRTVIQKAAEBasic
NLS Segment(s)
PositionSequence
103-119RHEKSRVNRRKARKRTR
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 9.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MGTTKNGNPPEPLKNGRFWTEEDVNSPDRLLRPNWDSWADNRSVWLREVTQLIRDRGPHWSNEMTAEELRDVPMQTLHEAIKAFFETTAKRYKINMHKTESERHEKSRVNRRKARKRTRTVIQKAAERTAHRESIAELRDKKYDFLFTWAYQSTDESDLEGAIDPGTDNEVQNEVPMVVGGRRPWISRAPAYRADGINNLLDRLDVTITAMRELPTVRTTKEKDGQTKPAVKISRTMIDPTWLQALAAKYDKPSFIAPEESDTSAEVPYEEDREQGQRDPNIDPLLYDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.53
4 0.5
5 0.46
6 0.46
7 0.45
8 0.43
9 0.39
10 0.4
11 0.37
12 0.35
13 0.32
14 0.27
15 0.24
16 0.26
17 0.24
18 0.26
19 0.29
20 0.32
21 0.37
22 0.38
23 0.37
24 0.37
25 0.4
26 0.36
27 0.31
28 0.3
29 0.29
30 0.27
31 0.26
32 0.26
33 0.21
34 0.22
35 0.26
36 0.24
37 0.28
38 0.32
39 0.33
40 0.33
41 0.33
42 0.32
43 0.37
44 0.38
45 0.32
46 0.31
47 0.31
48 0.29
49 0.3
50 0.3
51 0.24
52 0.23
53 0.22
54 0.17
55 0.16
56 0.16
57 0.15
58 0.13
59 0.11
60 0.12
61 0.12
62 0.12
63 0.14
64 0.13
65 0.14
66 0.14
67 0.13
68 0.13
69 0.12
70 0.12
71 0.1
72 0.12
73 0.12
74 0.15
75 0.23
76 0.23
77 0.24
78 0.25
79 0.34
80 0.42
81 0.51
82 0.54
83 0.51
84 0.58
85 0.6
86 0.66
87 0.64
88 0.63
89 0.56
90 0.52
91 0.54
92 0.51
93 0.56
94 0.59
95 0.62
96 0.63
97 0.68
98 0.76
99 0.8
100 0.86
101 0.89
102 0.89
103 0.88
104 0.86
105 0.87
106 0.87
107 0.83
108 0.81
109 0.73
110 0.68
111 0.61
112 0.57
113 0.5
114 0.4
115 0.39
116 0.33
117 0.3
118 0.25
119 0.23
120 0.2
121 0.23
122 0.24
123 0.24
124 0.22
125 0.23
126 0.26
127 0.26
128 0.26
129 0.2
130 0.21
131 0.17
132 0.19
133 0.2
134 0.17
135 0.19
136 0.19
137 0.18
138 0.16
139 0.16
140 0.13
141 0.12
142 0.12
143 0.09
144 0.09
145 0.08
146 0.08
147 0.08
148 0.06
149 0.04
150 0.04
151 0.03
152 0.03
153 0.05
154 0.06
155 0.05
156 0.06
157 0.07
158 0.07
159 0.07
160 0.08
161 0.06
162 0.05
163 0.05
164 0.05
165 0.04
166 0.06
167 0.06
168 0.09
169 0.11
170 0.12
171 0.14
172 0.18
173 0.22
174 0.26
175 0.31
176 0.33
177 0.37
178 0.39
179 0.41
180 0.37
181 0.35
182 0.31
183 0.27
184 0.25
185 0.2
186 0.17
187 0.13
188 0.12
189 0.1
190 0.1
191 0.08
192 0.05
193 0.07
194 0.09
195 0.1
196 0.11
197 0.11
198 0.1
199 0.11
200 0.12
201 0.13
202 0.14
203 0.16
204 0.17
205 0.24
206 0.27
207 0.34
208 0.41
209 0.45
210 0.5
211 0.55
212 0.62
213 0.62
214 0.67
215 0.61
216 0.61
217 0.58
218 0.5
219 0.49
220 0.45
221 0.42
222 0.36
223 0.37
224 0.3
225 0.3
226 0.3
227 0.27
228 0.25
229 0.19
230 0.17
231 0.17
232 0.18
233 0.19
234 0.21
235 0.2
236 0.2
237 0.23
238 0.24
239 0.22
240 0.23
241 0.22
242 0.23
243 0.27
244 0.25
245 0.28
246 0.31
247 0.29
248 0.28
249 0.25
250 0.23
251 0.18
252 0.17
253 0.12
254 0.11
255 0.11
256 0.15
257 0.14
258 0.14
259 0.17
260 0.21
261 0.24
262 0.27
263 0.33
264 0.33
265 0.35
266 0.36
267 0.39
268 0.38
269 0.35