Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7M508

Protein Details
Accession A0A1C7M508    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-52YETYTDKRGREKRRKRELPPGLSTRBasic
NLS Segment(s)
PositionSequence
34-44KRGREKRRKRE
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Amino Acid Sequences MTSDLAIKAGRKLFEKNLRQYAPEDPYYETYTDKRGREKRRKRELPPGLSTRDNKVLQSVKEACALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.54
4 0.6
5 0.58
6 0.57
7 0.55
8 0.52
9 0.46
10 0.4
11 0.34
12 0.26
13 0.28
14 0.29
15 0.27
16 0.22
17 0.18
18 0.23
19 0.27
20 0.26
21 0.32
22 0.39
23 0.49
24 0.59
25 0.69
26 0.73
27 0.79
28 0.87
29 0.85
30 0.87
31 0.86
32 0.83
33 0.81
34 0.75
35 0.68
36 0.65
37 0.61
38 0.55
39 0.53
40 0.46
41 0.38
42 0.4
43 0.41
44 0.36
45 0.43
46 0.41
47 0.35