Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LUU0

Protein Details
Accession A0A1C7LUU0   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MATADPKESWKKKTKKTLRNIILRRLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 6, cyto 6, cyto_nucl 6, pero 6, cyto_pero 6
Family & Domain DBs
Amino Acid Sequences MATADPKESWKKKTKKTLRNIILRRLVAIDQVTYAFPYNLSRFLLTAPRDNRCPRYEMSTNVHDRGPRGVDVDFGFPAVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.86
4 0.89
5 0.88
6 0.89
7 0.85
8 0.82
9 0.79
10 0.69
11 0.59
12 0.5
13 0.41
14 0.32
15 0.27
16 0.18
17 0.11
18 0.11
19 0.1
20 0.09
21 0.09
22 0.07
23 0.07
24 0.09
25 0.09
26 0.1
27 0.11
28 0.1
29 0.1
30 0.11
31 0.16
32 0.15
33 0.22
34 0.24
35 0.26
36 0.31
37 0.35
38 0.39
39 0.36
40 0.38
41 0.32
42 0.37
43 0.38
44 0.38
45 0.4
46 0.43
47 0.45
48 0.44
49 0.44
50 0.37
51 0.35
52 0.34
53 0.31
54 0.24
55 0.22
56 0.2
57 0.21
58 0.22
59 0.23
60 0.19
61 0.17