Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M309

Protein Details
Accession A0A1C7M309    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-103ELHRLHPHRLRHDQSRKLRCRVSPBasic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 6, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTSNASYSEFMLSLVPRQINFWISTTLAVWILAICSLVDLSSVACANVWLCLSLITGGLSMVTYTMHIDHDISFRLCSELHRLHPHRLRHDQSRKLRCRVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.17
4 0.16
5 0.17
6 0.19
7 0.2
8 0.21
9 0.2
10 0.17
11 0.16
12 0.17
13 0.15
14 0.14
15 0.12
16 0.1
17 0.08
18 0.06
19 0.06
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.09
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.12
66 0.19
67 0.21
68 0.27
69 0.37
70 0.4
71 0.49
72 0.56
73 0.62
74 0.63
75 0.69
76 0.7
77 0.71
78 0.77
79 0.78
80 0.81
81 0.85
82 0.84
83 0.83