Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MJM1

Protein Details
Accession A0A1C7MJM1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26VHVVRRLREKWKGQRKFLFEHydrophilic
NLS Segment(s)
PositionSequence
69-71KKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR027277  NadC/ModD  
IPR036068  Nicotinate_pribotase-like_C  
IPR002638  Quinolinate_PRibosylTrfase_C  
Gene Ontology GO:0004514  F:nicotinate-nucleotide diphosphorylase (carboxylating) activity  
GO:0009435  P:NAD biosynthetic process  
Pfam View protein in Pfam  
PF01729  QRPTase_C  
Amino Acid Sequences MEGDQLVHVVRRLREKWKGQRKFLFESSGNITETNLQERALNEIDILSTSVVHQSVQHIDFSLKIKMPKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.64
4 0.7
5 0.75
6 0.76
7 0.8
8 0.78
9 0.76
10 0.68
11 0.64
12 0.53
13 0.48
14 0.44
15 0.38
16 0.33
17 0.26
18 0.23
19 0.2
20 0.19
21 0.18
22 0.13
23 0.11
24 0.12
25 0.12
26 0.16
27 0.13
28 0.13
29 0.1
30 0.1
31 0.1
32 0.09
33 0.09
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.09
42 0.14
43 0.15
44 0.15
45 0.15
46 0.15
47 0.19
48 0.21
49 0.23
50 0.22
51 0.28