Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LWM8

Protein Details
Accession A0A1C7LWM8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-82AILACKRRARRMPCRVRCRHPCTHAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 4, plas 2, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLLAITSVVLCALTSANAGLLAYGICQSGCNALAVACYAGAGFTFGTVTAGVGTPAAILACKRRARRMPCRVRCRHPCTHAVNVGLHRYRYPVQTLYFFLRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.05
12 0.05
13 0.04
14 0.05
15 0.05
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.05
25 0.04
26 0.04
27 0.03
28 0.03
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.07
48 0.14
49 0.19
50 0.22
51 0.3
52 0.39
53 0.48
54 0.58
55 0.66
56 0.71
57 0.76
58 0.85
59 0.85
60 0.87
61 0.89
62 0.86
63 0.84
64 0.78
65 0.77
66 0.72
67 0.72
68 0.66
69 0.58
70 0.55
71 0.48
72 0.51
73 0.45
74 0.39
75 0.32
76 0.32
77 0.33
78 0.32
79 0.33
80 0.3
81 0.31
82 0.33
83 0.37